Apc6 (CDC16) (NM_003903) Human Recombinant Protein
CAT#: TP305639
Recombinant protein of human cell division cycle 16 homolog (S. cerevisiae) (CDC16), transcript variant 1, 20 µg
View other "Apc6" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205639 representing NM_003903
Red=Cloning site Green=Tags(s) MNLERLRKRVRQYLDQQQYQSALFWADKVASLSREEPQDIYWLAQCLYLTAQYHRAAHALRSRKLDKLYE ACRYLAARCHYAAKEHQQALDVLDMEEPINKRLFEKYLKDESGFKDPSSDWEMSQSSIKSSICLLRGKIY DALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQEEKELLESLPLSKLCNEEQELLRFLFENKLK KYNKPSETVIPESVDGLQENLDVVVSLAERHYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNK ANELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEH DQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKT AEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHS LMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAYIGADIKDKLKCYDFDVHTMKTLKNIIS PPWDFREFEVEKQTAEETGLTPLETSRKTPDSRPSLEETFEIEMNESDMMLETSMSDHST myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 71.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003894 |
Locus ID | 8881 |
UniProt ID | Q13042, A0A024RDZ2 |
Refseq Size | 2235 |
Cytogenetics | 13q34 |
Refseq ORF | 1860 |
Synonyms | ANAPC6; APC6; CDC16Hs; CUT9 |
Summary | The protein encoded by this gene functions as a protein ubiquitin ligase and is a component of the multiprotein APC complex. The APC complex is a cyclin degradation system that governs exit from mitosis by targeting cell cycle proteins for degredation by the 26S proteasome. Each component protein of the APC complex is highly conserved among eukaryotic organisms. This protein, and other APC complex proteins, contain a tetratricopeptide repeat (TPR) domain; a protein domain that is often involved in protein-protein interactions and the assembly of multiprotein complexes. Multiple alternatively spliced transcript variants, encoding distinct proteins, have been identified. [provided by RefSeq, Jan 2016] |
Protein Families | Druggable Genome |
Protein Pathways | Cell cycle, Oocyte meiosis, Progesterone-mediated oocyte maturation, Ubiquitin mediated proteolysis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418359 | CDC16 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421501 | CDC16 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY418359 | Transient overexpression lysate of cell division cycle 16 homolog (S. cerevisiae) (CDC16), transcript variant 1 |
CNY 3,080.00 |
|
LY421501 | Transient overexpression lysate of cell division cycle 16 homolog (S. cerevisiae) (CDC16), transcript variant 2 |
CNY 4,840.00 |
|
PH305639 | CDC16 MS Standard C13 and N15-labeled recombinant protein (NP_003894) |
CNY 19,520.00 |
|
PH324869 | CDC16 MS Standard C13 and N15-labeled recombinant protein (NP_001072113) |
CNY 19,520.00 |
|
TP324869 | Recombinant protein of human cell division cycle 16 homolog (S. cerevisiae) (CDC16), transcript variant 2, 20 µg |
CNY 2,900.00 |