United States
Germany
Japan
United Kingdom
China
BACE1 (NM_012104) Human Mass Spec Standard
CAT＃: PH309115
BACE1 MS Standard C13 and N15-labeled recombinant protein (NP_036236)
View other "BACE1" proteins (9)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | BACE1 MS Standard C13 and N15-labeled recombinant protein (NP_036236) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC209115 |
| Predicted MW | 55.8 kDa |
| Protein Sequence |
>RC209115 protein sequence
Red=Cloning site Green=Tags(s) MAQALPWLLLWMGAGVLPAHGTQHGIRLPLRSGLGGAPLGLRLPRETDEEPEEPGRRGSFVEMVDNLRGK SGQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTYRDLRKGVYVPYTQGKWEGE LGTDLVSIPHGPNVTVRANIAAITESDKFFINGSNWEGILGLAYAEIARPDDSLEPFFDSLVKQTHVPNL FSLQLCGAGFPLNQSEVLASVGGSMIIGGIDHSLYTGSLWYTPIRREWYYEVIIVRVEINGQDLKMDCKE YNYDKSIVDSGTTNLRLPKKVFEAAVKSIKAASSTEKFPDGFWLGEQLVCWQAGTTPWNIFPVISLYLMG EVTNQSFRITILPQQYLRPVEDVATSQDDCYKFAISQSSTGTVMGAVIMEGFYVVFDRARKRIGFAVSAC HVHDEFRTAAVEGPFVTLDMEDCGYNIPQTDESTLMTIAYVMAAICALFMLPLCLMVCQWRCLRCLRQQH DDFADDISLLK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_036236 |
| RefSeq Size | 5864 |
| RefSeq ORF | 1503 |
| Synonyms | ASP2; BACE; HSPC104 |
| Locus ID | 23621 |
| Cytogenetics | 11q23.3 |
| Summary | This gene encodes a member of the peptidase A1 family of aspartic proteases. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature protease. This transmembrane protease catalyzes the first step in the formation of amyloid beta peptide from amyloid precursor protein. Amyloid beta peptides are the main constituent of amyloid beta plaques, which accumulate in the brains of human Alzheimer's disease patients. [provided by RefSeq, Nov 2015] |
| Protein Families | Druggable Genome, Protease, Transmembrane |
| Protein Pathways | Alzheimer's disease |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402147 | BACE1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC408446 | BACE1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC408448 | BACE1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC430074 | BACE1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402147 | Transient overexpression lysate of beta-site APP-cleaving enzyme 1 (BACE1), transcript variant a |
CNY 3,080.00 |
|
| LY408446 | Transient overexpression lysate of beta-site APP-cleaving enzyme 1 (BACE1), transcript variant c |
CNY 4,840.00 |
|
| LY408448 | Transient overexpression lysate of beta-site APP-cleaving enzyme 1 (BACE1), transcript variant d |
CNY 4,840.00 |
|
| LY430074 | Transient overexpression lysate of beta-site APP-cleaving enzyme 1 (BACE1), transcript variant c |
CNY 3,080.00 |
|
| TP309115 | Recombinant protein of human beta-site APP-cleaving enzyme 1 (BACE1), transcript variant a, 20 µg |
CNY 2,900.00 |
