BACE1 (NM_012104) Human Recombinant Protein
CAT#: TP309115
Recombinant protein of human beta-site APP-cleaving enzyme 1 (BACE1), transcript variant a, 20 µg
View other "BACE1" proteins (9)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209115 protein sequence
Red=Cloning site Green=Tags(s) MAQALPWLLLWMGAGVLPAHGTQHGIRLPLRSGLGGAPLGLRLPRETDEEPEEPGRRGSFVEMVDNLRGK SGQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTYRDLRKGVYVPYTQGKWEGE LGTDLVSIPHGPNVTVRANIAAITESDKFFINGSNWEGILGLAYAEIARPDDSLEPFFDSLVKQTHVPNL FSLQLCGAGFPLNQSEVLASVGGSMIIGGIDHSLYTGSLWYTPIRREWYYEVIIVRVEINGQDLKMDCKE YNYDKSIVDSGTTNLRLPKKVFEAAVKSIKAASSTEKFPDGFWLGEQLVCWQAGTTPWNIFPVISLYLMG EVTNQSFRITILPQQYLRPVEDVATSQDDCYKFAISQSSTGTVMGAVIMEGFYVVFDRARKRIGFAVSAC HVHDEFRTAAVEGPFVTLDMEDCGYNIPQTDESTLMTIAYVMAAICALFMLPLCLMVCQWRCLRCLRQQH DDFADDISLLK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 55.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_036236 |
Locus ID | 23621 |
UniProt ID | P56817, A0A024R3D7 |
Refseq Size | 5864 |
Cytogenetics | 11q23.3 |
Refseq ORF | 1503 |
Synonyms | ASP2; BACE; HSPC104 |
Summary | This gene encodes a member of the peptidase A1 family of aspartic proteases. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature protease. This transmembrane protease catalyzes the first step in the formation of amyloid beta peptide from amyloid precursor protein. Amyloid beta peptides are the main constituent of amyloid beta plaques, which accumulate in the brains of human Alzheimer's disease patients. [provided by RefSeq, Nov 2015] |
Protein Families | Druggable Genome, Protease, Transmembrane |
Protein Pathways | Alzheimer's disease |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402147 | BACE1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC408446 | BACE1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC408448 | BACE1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC430074 | BACE1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402147 | Transient overexpression lysate of beta-site APP-cleaving enzyme 1 (BACE1), transcript variant a |
CNY 3,080.00 |
|
LY408446 | Transient overexpression lysate of beta-site APP-cleaving enzyme 1 (BACE1), transcript variant c |
CNY 4,840.00 |
|
LY408448 | Transient overexpression lysate of beta-site APP-cleaving enzyme 1 (BACE1), transcript variant d |
CNY 4,840.00 |
|
LY430074 | Transient overexpression lysate of beta-site APP-cleaving enzyme 1 (BACE1), transcript variant c |
CNY 3,080.00 |
|
PH309115 | BACE1 MS Standard C13 and N15-labeled recombinant protein (NP_036236) |
CNY 19,520.00 |