SOCS3 (NM_003955) Human Mass Spec Standard
CAT#: PH309305
SOCS3 MS Standard C13 and N15-labeled recombinant protein (NP_003946)
View other "SOCS3" proteins (1)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | SOCS3 MS Standard C13 and N15-labeled recombinant protein (NP_003946) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209305 |
Predicted MW | 24.8 kDa |
Protein Sequence |
>RC209305 protein sequence
Red=Cloning site Green=Tags(s) MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLI RDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFPSPP TEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQL PGPIREFLDQYDAPL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003946 |
RefSeq Size | 2737 |
RefSeq ORF | 675 |
Synonyms | ATOD4; CIS3; Cish3; SOCS-3; SSI-3; SSI3 |
Locus ID | 9021 |
Cytogenetics | 17q25.3 |
Summary | This gene encodes a member of the STAT-induced STAT inhibitor (SSI), also known as suppressor of cytokine signaling (SOCS), family. SSI family members are cytokine-inducible negative regulators of cytokine signaling. The expression of this gene is induced by various cytokines, including IL6, IL10, and interferon (IFN)-gamma. The protein encoded by this gene can bind to JAK2 kinase, and inhibit the activity of JAK2 kinase. Studies of the mouse counterpart of this gene suggested the roles of this gene in the negative regulation of fetal liver hematopoiesis, and placental development. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Adipocytokine signaling pathway, Insulin signaling pathway, Jak-STAT signaling pathway, Type II diabetes mellitus, Ubiquitin mediated proteolysis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
TP309305 | Recombinant protein of human suppressor of cytokine signaling 3 (SOCS3), 20 µg |
CNY 2,900.00 |