SCP3 (SYCP3) (NM_153694) Human Mass Spec Standard
CAT#: PH309340
SYCP3 MS Standard C13 and N15-labeled recombinant protein (NP_710161)
View other "SCP3" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | SYCP3 MS Standard C13 and N15-labeled recombinant protein (NP_710161) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209340 |
Predicted MW | 27.7 kDa |
Protein Sequence |
>RC209340 protein sequence
Red=Cloning site Green=Tags(s) MVSSGKKYSRKSGKPSVEDQFTRAYDFETEDKKDLSGSEEDVIEGKTAVIEKRRKKRSSAGVVEDMGGEV QNMLEGVGVDINKALLAKRKRLEMYTKASLKTSNQKIEHVWKTQQDQRQKLNQEYSQQFLTLFQQWDLDM QKAEEQEEKILNMFRQQQKILQQSRIVQSQRLKTIKQLYEQFIKSMEELEKNHDNLLTGAQNEFKKEMAM LQKKIMMETQQQEIASVRKSLQSMLF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_710161 |
RefSeq Size | 1137 |
RefSeq ORF | 708 |
Synonyms | COR1; RPRGL4; SCP3; SPGF4 |
Locus ID | 50511 |
Cytogenetics | 12q23.2 |
Summary | This gene encodes an essential structural component of the synaptonemal complex. This complex is involved in synapsis, recombination and segregation of meiotic chromosomes. Mutations in this gene are associated with azoospermia in males and susceptibility to pregnancy loss in females. Alternate splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, May 2010] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406978 | SYCP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC432740 | SYCP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406978 | Transient overexpression lysate of synaptonemal complex protein 3 (SYCP3) |
CNY 3,080.00 |
|
LY432740 | Transient overexpression lysate of synaptonemal complex protein 3 (SYCP3), transcript variant 1 |
CNY 3,080.00 |
|
TP309340 | Recombinant protein of human synaptonemal complex protein 3 (SYCP3), 20 µg |
CNY 2,900.00 |