Osteopontin (SPP1) (NM_001040060) Human Mass Spec Standard
CAT#: PH310592
SPP1 MS Standard C13 and N15-labeled recombinant protein (NP_001035149)
View other "Osteopontin" proteins (13)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
CNY 3,080.00
Specifications
Product Data | |
Description | SPP1 MS Standard C13 and N15-labeled recombinant protein (NP_001035149) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210592 |
Predicted MW | 32.4 kDa |
Protein Sequence |
>RC210592 protein sequence
Red=Cloning site Green=Tags(s) MRIAVICFCLLGITCAIPVKQADSGSSEEKQNAVSSEETNDFKQETLPSKSNESHDHMDDMDDEDDDDHV DSQDSIDSNDSDDVDDTDDSHQSDESHHSDESDELVTDFPTDLPATEVFTPVVPTVDTYDGRGDSVVYGL RSKSKKFRRPDIQYPDATDEDITSHMESEELNGAYKAIPVAQDLNAPSDWDSRGKDSYETSQLDDQSAET HSHKQSRLYKRKANDESNEHSDVIDSQELSKVSREFHSHEFHSHEDMLVVDPKSKEEDKHLKFRISHELD SASSEVN myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001035149 |
RefSeq Size | 1560 |
RefSeq ORF | 861 |
Synonyms | BNSP; BSPI; ETA-1; OPN |
Locus ID | 6696 |
Cytogenetics | 4q22.1 |
Summary | The protein encoded by this gene is involved in the attachment of osteoclasts to the mineralized bone matrix. The encoded protein is secreted and binds hydroxyapatite with high affinity. The osteoclast vitronectin receptor is found in the cell membrane and may be involved in the binding to this protein. This protein is also a cytokine that upregulates expression of interferon-gamma and interleukin-12. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | ECM-receptor interaction, Focal adhesion, Toll-like receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400422 | SPP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421887 | SPP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424632 | SPP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400422 | Transient overexpression lysate of secreted phosphoprotein 1 (SPP1), transcript variant 3 |
CNY 3,080.00 |
|
LY421887 | Transient overexpression lysate of secreted phosphoprotein 1 (SPP1), transcript variant 1 |
CNY 3,080.00 |
|
LY424632 | Transient overexpression lysate of secreted phosphoprotein 1 (SPP1), transcript variant 2 |
CNY 3,080.00 |
|
PH304803 | SPP1 MS Standard C13 and N15-labeled recombinant protein (NP_001035147) |
CNY 14,250.00 |
|
PH305118 | SPP1 MS Standard C13 and N15-labeled recombinant protein (NP_000573) |
CNY 14,250.00 |
|
TP304803 | Purified recombinant protein of Homo sapiens secreted phosphoprotein 1 (SPP1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP305118 | Purified recombinant protein of Homo sapiens secreted phosphoprotein 1 (SPP1), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP310592 | Purified recombinant protein of human secreted phosphoprotein 1 (SPP1), transcript variant 3, with C-terminal MYC/DDK tag, secretory expressed in HEK293 cells, 20 µg |
CNY 2,900.00 |
|
TP710213 | Purified protein of Homo sapiens secreted phosphoprotein 1 (SPP1), transcript variant 1, residues 17-314aa, secretory expressed with GP67 signal peptide, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4,020.00 |
|
TP720449 | Recombinant protein of human secreted phosphoprotein 1 (SPP1), transcript variant 2 |
CNY 1,800.00 |
其它Osteopontin产品