United States
Germany
Japan
United Kingdom
China
Parathyroid hormone related protein (PTHLH) (NM_002820) Human Mass Spec Standard
CAT＃: PH312858
PTHLH MS Standard C13 and N15-labeled recombinant protein (NP_002811)
View other "Parathyroid hormone related protein" proteins (14)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | PTHLH MS Standard C13 and N15-labeled recombinant protein (NP_002811) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC212858 |
| Predicted MW | 19.9 kDa |
| Protein Sequence |
>RC212858 representing NM_002820
Red=Cloning site Green=Tags(s) MQRRLVQQWSVAVFLLSYAVPSCGRSVEGLSRRLKRAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTA EIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKK RRTRSAWLDSGVTGSGLEGDHLSDTSTTSLELDSR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002811 |
| RefSeq Size | 1881 |
| RefSeq ORF | 525 |
| Synonyms | BDE2; HHM; PLP; PTHR; PTHRP |
| Locus ID | 5744 |
| Cytogenetics | 12p11.22 |
| Summary | The protein encoded by this gene is a member of the parathyroid hormone family. This hormone, via its receptor, PTHR1, regulates endochondral bone development and epithelial-mesenchymal interactions during the formation of the mammary glands and teeth. It is responsible for most cases of humoral hypercalcemia of malignancy, and mutations in this gene are associated with brachydactyly type E2 (BDE2). Alternatively spliced transcript variants have been found for this gene. There is also evidence for alternative translation initiation from non-AUG (CUG and GUG) start sites, downstream of the initiator AUG codon, resulting in nuclear forms of this hormone. [provided by RefSeq, Nov 2013] |
| Protein Families | Druggable Genome, Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401000 | PTHLH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404641 | PTHLH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404642 | PTHLH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404643 | PTHLH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC430780 | PTHLH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401000 | Transient overexpression lysate of parathyroid hormone-like hormone (PTHLH), transcript variant 2 |
CNY 3,080.00 |
|
| LY404641 | Transient overexpression lysate of parathyroid hormone-like hormone (PTHLH), transcript variant 3 |
CNY 3,080.00 |
|
| LY404642 | Transient overexpression lysate of parathyroid hormone-like hormone (PTHLH), transcript variant 1 |
CNY 3,080.00 |
|
| LY404643 | Transient overexpression lysate of parathyroid hormone-like hormone (PTHLH), transcript variant 4 |
CNY 3,080.00 |
|
| LY430780 | Transient overexpression lysate of parathyroid hormone-like hormone (PTHLH), transcript variant 4 |
CNY 3,080.00 |
|
| PH312744 | PTHLH MS Standard C13 and N15-labeled recombinant protein (NP_945317) |
CNY 19,520.00 |
|
| TP312744 | Recombinant protein of human parathyroid hormone-like hormone (PTHLH), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
| TP312858 | Recombinant protein of human parathyroid hormone-like hormone (PTHLH), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP760737 | Purified recombinant protein of Human parathyroid hormone-like hormone (PTHLH), transcript variant 3, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |
其它Parathyroid hormone related protein产品
