Bcl2 Binding component 3 (BBC3) (NM_014417) Human Mass Spec Standard
CAT#: PH313203
BBC3 MS Standard C13 and N15-labeled recombinant protein (NP_055232)
View other "Bcl2 Binding component 3" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | BBC3 MS Standard C13 and N15-labeled recombinant protein (NP_055232) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC213203 |
Predicted MW | 20.4 kDa |
Protein Sequence |
>RC213203 representing NM_014417
Red=Cloning site Green=Tags(s) MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLAAAPAAPTLLPAAYLCAPTAPPAVTA ALGGSRWPGGPRSRPRGPRPDGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQ LRRMADDLNAQYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_055232 |
RefSeq Size | 1840 |
RefSeq ORF | 579 |
Synonyms | JFY-1; JFY1; PUMA |
Locus ID | 27113 |
Cytogenetics | 19q13.32 |
Summary | This gene encodes a member of the BCL-2 family of proteins. This family member belongs to the BH3-only pro-apoptotic subclass. The protein cooperates with direct activator proteins to induce mitochondrial outer membrane permeabilization and apoptosis. It can bind to anti-apoptotic Bcl-2 family members to induce mitochondrial dysfunction and caspase activation. Because of its pro-apoptotic role, this gene is a potential drug target for cancer therapy and for tissue injury. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2011] |
Protein Families | Druggable Genome |
Protein Pathways | Huntington's disease, p53 signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402330 | BBC3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426734 | BBC3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402330 | Transient overexpression lysate of BCL2 binding component 3 (BBC3), transcript variant 4 |
CNY 3,080.00 |
|
LY426734 | Transient overexpression lysate of BCL2 binding component 3 (BBC3), transcript variant 1 |
CNY 3,080.00 |
|
PH325345 | BBC3 MS Standard C13 and N15-labeled recombinant protein (NP_001120712) |
CNY 19,520.00 |
|
TP313203 | Recombinant protein of human BCL2 binding component 3 (BBC3), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
TP325345 | Recombinant protein of human BCL2 binding component 3 (BBC3), transcript variant 1, 20 µg |
CNY 2,900.00 |
其它Bcl2 Binding component 3产品