Bcl2 Binding component 3 (BBC3) (NM_001127240) Human Recombinant Protein
CAT#: TP325345
Recombinant protein of human BCL2 binding component 3 (BBC3), transcript variant 1, 20 µg
View other "Bcl2 Binding component 3" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 2 publications. |
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC225345 representing NM_001127240
Red=Cloning site Green=Tags(s) MKFGMGSAQACPCQVPRAASTTWVPCQICGPRERHGPRTPGGQLPGARRGPGPRRPAPLPARPPGALGSV LRPLRARPGCRPRRPHPAARCLPLRPHRPTRRHRRPGGFPLAWGSPQPAPRPAPGRSSALALAGGAAPGV ARAQRPGGSGGRSHPGGPGSPRGGGTVGPGDRGPAAADGGRPQRTVRAAETRGAAAAPPLTLEGPVQSHH GTPALTQGPQSPRDGAQLGACTRPVDVRDSGGRPLPPPDTLASAGDFLCTM myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 26.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001120712 |
Locus ID | 27113 |
UniProt ID | Q96PG8 |
Cytogenetics | 19q13.32 |
Refseq ORF | 783 |
Synonyms | JFY-1; JFY1; PUMA |
Summary | This gene encodes a member of the BCL-2 family of proteins. This family member belongs to the BH3-only pro-apoptotic subclass. The protein cooperates with direct activator proteins to induce mitochondrial outer membrane permeabilization and apoptosis. It can bind to anti-apoptotic Bcl-2 family members to induce mitochondrial dysfunction and caspase activation. Because of its pro-apoptotic role, this gene is a potential drug target for cancer therapy and for tissue injury. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2011] |
Protein Families | Druggable Genome |
Protein Pathways | Huntington's disease, p53 signaling pathway |
Citations (2)
The use of this Proteins has been cited in the following citations: |
---|
Using CETSA assay and a mathematical model to reveal dual Bcl-2/Mcl-1 inhibition and on-target mechanism for ABT-199 and S1
,Guo, Z;Song, T;Xue, Z;Liu, P;Zhang, M;Zhang, X;Zhang, Z;,
Eur J Pharm Sci
,PubMed ID 31669390
[BBC3]
|
HER2 Phosphorylates and Destabilizes Pro-Apoptotic PUMA, Leading to Antagonized Apoptosis in Cancer Cells
,Carpenter, RL;Han, W;Paw, I;Lo, HW;,
PLoS ONE e78836
,PubMed ID 24236056
[BBC3]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402330 | BBC3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426734 | BBC3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402330 | Transient overexpression lysate of BCL2 binding component 3 (BBC3), transcript variant 4 |
CNY 3,080.00 |
|
LY426734 | Transient overexpression lysate of BCL2 binding component 3 (BBC3), transcript variant 1 |
CNY 3,080.00 |
|
PH313203 | BBC3 MS Standard C13 and N15-labeled recombinant protein (NP_055232) |
CNY 19,520.00 |
|
PH325345 | BBC3 MS Standard C13 and N15-labeled recombinant protein (NP_001120712) |
CNY 19,520.00 |
|
TP313203 | Recombinant protein of human BCL2 binding component 3 (BBC3), transcript variant 4, 20 µg |
CNY 2,900.00 |
其它Bcl2 Binding component 3产品