United States
Germany
Japan
United Kingdom
China
PCBP2 (NM_001098620) Human Mass Spec Standard
CAT＃: PH313289
PCBP2 MS Standard C13 and N15-labeled recombinant protein (NP_001092090)
View other "PCBP2" proteins (21)
|
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Product images
Specifications
| Product Data | |
| Description | PCBP2 MS Standard C13 and N15-labeled recombinant protein (NP_001092090) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC213289 |
| Predicted MW | 34.7 kDa |
| Protein Sequence |
>RC213289 representing NM_001098620
Red=Cloning site Green=Tags(s) MDTGVIEGGLNVTLTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISEGNCPERIITLAGPTNAIFK AFAMIIDKLEEDISSSMTNSTAASRPPVTLRLVVPASQCGSLIGKGGCKIKEIRESTGAQVQVAGDMLPN STERAITIAGIPQSIIECVKQICVVMLESPPKGVTIPYRPKPSSSPVIFAGGQAYTIQGQYAIPQPDLTK LHQLAMQQSHFPMTHGNTGFSGIESSSPEVKGYWAGLDASAQTTSHELTIPNDLIGCIIGRQGAKINEIR QMSGAQIKIANPVEGSTDRQVTITGSAASISLAQYLINVRLSSETGGMGSS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001092090 |
| RefSeq Size | 1717 |
| RefSeq ORF | 993 |
| Synonyms | hnRNP-E2; HNRNPE2; HNRPE2 |
| Locus ID | 5094 |
| Cytogenetics | 12q13.13 |
| Summary | The protein encoded by this gene appears to be multifunctional. Along with PCBP-1 and hnRNPK, it is one of the major cellular poly(rC)-binding proteins. The encoded protein contains three K-homologous (KH) domains which may be involved in RNA binding. Together with PCBP-1, this protein also functions as a translational coactivator of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES, promoting poliovirus RNA replication by binding to its 5'-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA. The encoded protein is also suggested to play a part in formation of a sequence-specific alpha-globin mRNP complex which is associated with alpha-globin mRNA stability. This multiexon structural mRNA is thought to be retrotransposed to generate PCBP-1, an intronless gene with functions similar to that of PCBP2. This gene and PCBP-1 have paralogous genes (PCBP3 and PCBP4) which are thought to have arisen as a result of duplication events of entire genes. This gene also has two processed pseudogenes (PCBP2P1 and PCBP2P2). Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2018] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403134 | PCBP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC417574 | PCBP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420644 | PCBP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427015 | PCBP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427016 | PCBP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC429233 | PCBP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403134 | Transient overexpression lysate of poly(rC) binding protein 2 (PCBP2), transcript variant 2 |
CNY 3,080.00 |
|
| LY417574 | Transient overexpression lysate of poly(rC) binding protein 2 (PCBP2), transcript variant 1 |
CNY 3,080.00 |
|
| LY420644 | Transient overexpression lysate of poly(rC) binding protein 2 (PCBP2), transcript variant 3 |
CNY 3,080.00 |
|
| LY427015 | Transient overexpression lysate of poly(rC) binding protein 2 (PCBP2), transcript variant 6 |
CNY 3,080.00 |
|
| LY427016 | Transient overexpression lysate of poly(rC) binding protein 2 (PCBP2), transcript variant 7 |
CNY 3,080.00 |
|
| LY429233 | Transient overexpression lysate of poly(rC) binding protein 2 (PCBP2), transcript variant 1 |
CNY 3,080.00 |
|
| PH300339 | PCBP2 MS Standard C13 and N15-labeled recombinant protein (NP_114366) |
CNY 19,520.00 |
|
| PH310035 | PCBP2 MS Standard C13 and N15-labeled recombinant protein (NP_005007) |
CNY 19,520.00 |
|
| PH325457 | PCBP2 MS Standard C13 and N15-labeled recombinant protein (NP_001122386) |
CNY 14,250.00 |
|
| PH325491 | PCBP2 MS Standard C13 and N15-labeled recombinant protein (NP_001122385) |
CNY 14,250.00 |
|
| TP300339 | Recombinant protein of human poly(rC) binding protein 2 (PCBP2), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP310035 | Recombinant protein of human poly(rC) binding protein 2 (PCBP2), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP313289 | Purified recombinant protein of Homo sapiens poly(rC) binding protein 2 (PCBP2), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP325457 | Purified recombinant protein of Homo sapiens poly(rC) binding protein 2 (PCBP2), transcript variant 7, 20 µg |
CNY 2,900.00 |
|
| TP325491 | Purified recombinant protein of Homo sapiens poly(rC) binding protein 2 (PCBP2), transcript variant 6, 20 µg |
CNY 2,900.00 |
