PCBP2 (NM_001128913) Human Mass Spec Standard
CAT#: PH325491
PCBP2 MS Standard C13 and N15-labeled recombinant protein (NP_001122385)
View other "PCBP2" proteins (21)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Specifications
Product Data | |
Description | PCBP2 MS Standard C13 and N15-labeled recombinant protein (NP_001122385) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC225491 |
Predicted MW | 35.2 kDa |
Protein Sequence |
>RC225491 representing NM_001128913
Red=Cloning site Green=Tags(s) MDTGVIEGGLNVTLTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISEGNCPERIITLAGPTNAIFK AFAMIIDKLEEDISSSMTNSTAASRPPVTLRLVVPASQCGSLIGKGGCKIKEIRESTGAQVQVAGDMLPN STERAITIAGIPQSIIECVKQICVVMLETLSQSPPKGVTIPYRPKPSSSPVIFAGGQAYTIQGQYAIPQP DLTKLHQLAMQQSHFPMTHGNTGFSGIESSSPEVKGYWAGLDASAQTTSHELTIPNDLIGCIIGRQGAKI NEIRQMSGAQIKIANPVEGSTDRQVTITGSAASISLAQYLINVRLSSETGGMGSS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001122385 |
RefSeq ORF | 1005 |
Synonyms | hnRNP-E2; HNRNPE2; HNRPE2 |
Locus ID | 5094 |
Cytogenetics | 12q13.13 |
Summary | The protein encoded by this gene appears to be multifunctional. Along with PCBP-1 and hnRNPK, it is one of the major cellular poly(rC)-binding proteins. The encoded protein contains three K-homologous (KH) domains which may be involved in RNA binding. Together with PCBP-1, this protein also functions as a translational coactivator of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES, promoting poliovirus RNA replication by binding to its 5'-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA. The encoded protein is also suggested to play a part in formation of a sequence-specific alpha-globin mRNP complex which is associated with alpha-globin mRNA stability. This multiexon structural mRNA is thought to be retrotransposed to generate PCBP-1, an intronless gene with functions similar to that of PCBP2. This gene and PCBP-1 have paralogous genes (PCBP3 and PCBP4) which are thought to have arisen as a result of duplication events of entire genes. This gene also has two processed pseudogenes (PCBP2P1 and PCBP2P2). Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2018] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403134 | PCBP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC417574 | PCBP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420644 | PCBP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427015 | PCBP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427016 | PCBP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC429233 | PCBP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403134 | Transient overexpression lysate of poly(rC) binding protein 2 (PCBP2), transcript variant 2 |
CNY 3,080.00 |
|
LY417574 | Transient overexpression lysate of poly(rC) binding protein 2 (PCBP2), transcript variant 1 |
CNY 3,080.00 |
|
LY420644 | Transient overexpression lysate of poly(rC) binding protein 2 (PCBP2), transcript variant 3 |
CNY 3,080.00 |
|
LY427015 | Transient overexpression lysate of poly(rC) binding protein 2 (PCBP2), transcript variant 6 |
CNY 3,080.00 |
|
LY427016 | Transient overexpression lysate of poly(rC) binding protein 2 (PCBP2), transcript variant 7 |
CNY 3,080.00 |
|
LY429233 | Transient overexpression lysate of poly(rC) binding protein 2 (PCBP2), transcript variant 1 |
CNY 3,080.00 |
|
PH300339 | PCBP2 MS Standard C13 and N15-labeled recombinant protein (NP_114366) |
CNY 19,520.00 |
|
PH310035 | PCBP2 MS Standard C13 and N15-labeled recombinant protein (NP_005007) |
CNY 19,520.00 |
|
PH313289 | PCBP2 MS Standard C13 and N15-labeled recombinant protein (NP_001092090) |
CNY 14,250.00 |
|
PH325457 | PCBP2 MS Standard C13 and N15-labeled recombinant protein (NP_001122386) |
CNY 14,250.00 |
|
TP300339 | Recombinant protein of human poly(rC) binding protein 2 (PCBP2), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP310035 | Recombinant protein of human poly(rC) binding protein 2 (PCBP2), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP313289 | Purified recombinant protein of Homo sapiens poly(rC) binding protein 2 (PCBP2), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
TP325457 | Purified recombinant protein of Homo sapiens poly(rC) binding protein 2 (PCBP2), transcript variant 7, 20 µg |
CNY 2,900.00 |
|
TP325491 | Purified recombinant protein of Homo sapiens poly(rC) binding protein 2 (PCBP2), transcript variant 6, 20 µg |
CNY 2,900.00 |