PCBP2 (NM_031989) Human Recombinant Protein
CAT#: TP300339
Recombinant protein of human poly(rC) binding protein 2 (PCBP2), transcript variant 2, 20 µg
View other "PCBP2" proteins (21)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200339 protein sequence
Red=Cloning site Green=Tags(s) MDTGVIEGGLNVTLTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISEGNCPERIITLAGPTNAIFK AFAMIIDKLEEDISSSMTNSTAASRPPVTLRLVVPASQCGSLIGKGGCKIKEIRESTGAQVQVAGDMLPN STERAITIAGIPQSIIECVKQICVVMLESPPKGVTIPYRPKPSSSPVIFAGGQDRYSTGSDSASFPHTTP SMCLNPDLEGPPLEAYTIQGQYAIPQPDLTKLHQLAMQQSHFPMTHGNTGFSGIESSSPEVKGYWAGLDA SAQTTSHELTIPNDLIGCIIGRQGAKINEIRQMSGAQIKIANPVEGSTDRQVTITGSAASISLAQYLINV RLSSETGGMGSS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 38 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_114366 |
Locus ID | 5094 |
UniProt ID | Q15366 |
Refseq Size | 3175 |
Cytogenetics | 12q13.13 |
Refseq ORF | 1086 |
Synonyms | hnRNP-E2; HNRNPE2; HNRPE2 |
Summary | The protein encoded by this gene appears to be multifunctional. Along with PCBP-1 and hnRNPK, it is one of the major cellular poly(rC)-binding proteins. The encoded protein contains three K-homologous (KH) domains which may be involved in RNA binding. Together with PCBP-1, this protein also functions as a translational coactivator of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES, promoting poliovirus RNA replication by binding to its 5'-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA. The encoded protein is also suggested to play a part in formation of a sequence-specific alpha-globin mRNP complex which is associated with alpha-globin mRNA stability. This multiexon structural mRNA is thought to be retrotransposed to generate PCBP-1, an intronless gene with functions similar to that of PCBP2. This gene and PCBP-1 have paralogous genes (PCBP3 and PCBP4) which are thought to have arisen as a result of duplication events of entire genes. This gene also has two processed pseudogenes (PCBP2P1 and PCBP2P2). Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2018] |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Unique C. elegans telomeric overhang structures reveal the evolutionarily conserved properties of telomeric DNA
,null,
Nucleic Acids Research
,PubMed ID 25855805
[PCBP2]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403134 | PCBP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC417574 | PCBP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420644 | PCBP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427015 | PCBP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427016 | PCBP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC429233 | PCBP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403134 | Transient overexpression lysate of poly(rC) binding protein 2 (PCBP2), transcript variant 2 |
CNY 3,080.00 |
|
LY417574 | Transient overexpression lysate of poly(rC) binding protein 2 (PCBP2), transcript variant 1 |
CNY 3,080.00 |
|
LY420644 | Transient overexpression lysate of poly(rC) binding protein 2 (PCBP2), transcript variant 3 |
CNY 3,080.00 |
|
LY427015 | Transient overexpression lysate of poly(rC) binding protein 2 (PCBP2), transcript variant 6 |
CNY 3,080.00 |
|
LY427016 | Transient overexpression lysate of poly(rC) binding protein 2 (PCBP2), transcript variant 7 |
CNY 3,080.00 |
|
LY429233 | Transient overexpression lysate of poly(rC) binding protein 2 (PCBP2), transcript variant 1 |
CNY 3,080.00 |
|
PH300339 | PCBP2 MS Standard C13 and N15-labeled recombinant protein (NP_114366) |
CNY 19,520.00 |
|
PH310035 | PCBP2 MS Standard C13 and N15-labeled recombinant protein (NP_005007) |
CNY 19,520.00 |
|
PH313289 | PCBP2 MS Standard C13 and N15-labeled recombinant protein (NP_001092090) |
CNY 14,250.00 |
|
PH325457 | PCBP2 MS Standard C13 and N15-labeled recombinant protein (NP_001122386) |
CNY 14,250.00 |
|
PH325491 | PCBP2 MS Standard C13 and N15-labeled recombinant protein (NP_001122385) |
CNY 14,250.00 |
|
TP310035 | Recombinant protein of human poly(rC) binding protein 2 (PCBP2), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP313289 | Purified recombinant protein of Homo sapiens poly(rC) binding protein 2 (PCBP2), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
TP325457 | Purified recombinant protein of Homo sapiens poly(rC) binding protein 2 (PCBP2), transcript variant 7, 20 µg |
CNY 2,900.00 |
|
TP325491 | Purified recombinant protein of Homo sapiens poly(rC) binding protein 2 (PCBP2), transcript variant 6, 20 µg |
CNY 2,900.00 |