SHP1 (PTPN6) (NM_002831) Human Mass Spec Standard
CAT#: PH313896
PTPN6 MS Standard C13 and N15-labeled recombinant protein (NP_002822)
View other "SHP1" proteins (8)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | PTPN6 MS Standard C13 and N15-labeled recombinant protein (NP_002822) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC213896 |
Predicted MW | 67.4 kDa |
Protein Sequence |
>RC213896 representing NM_002831
Red=Cloning site Green=Tags(s) MVRWFHRDLSGLDAETLLKGRGVHGSFLARPSRKNQGDFSLSVRVGDQVTHIRIQNSGDFYDLYGGEKFA TLTELVEYYTQQQGVLQDRDGTIIHLKYPLNCSDPTSERWYHGHMSGGQAETLLQAKGEPWTFLVRESLS QPGDFVLSVLSDQPKAGPGSPLRVTHIKVMCEGGRYTVGGLETFDSLTDLVEHFKKTGIEEASGAFVYLR QPYYATRVNAADIENRVLELNKKQESEDTAKAGFWEEFESLQKQEVKNLHQRLEGQRPENKGKNRYKNIL PFDHSRVILQGRDSNIPGSDYINANYIKNQLLGPDENAKTYIASQGCLEATVNDFWQMAWQENSRVIVMT TREVEKGRNKCVPYWPEVGMQRAYGPYSVTNCGEHDTTEYKLRTLQVSPLDNGDLIREIWHYQYLSWPDH GVPSEPGGVLSFLDQINQRQESLPHAGPIIVHCSAGIGRTGTIIVIDMLMENISTKGLDCDIDIQKTIQM VRAQRSGMVQTEAQYKFIYVAIAQFIETTKKKLEVLQSQKGQESEYGNITYPPAMKNAHAKASRTSSKHK EDVYENLHTKNKREEKVKKQRSADKEKSKGSLKRK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002822 |
RefSeq Size | 2253 |
RefSeq ORF | 1785 |
Synonyms | HCP; HCPH; HPTP1C; PTP-1C; SH-PTP1; SHP-1; SHP-1L; SHP1 |
Locus ID | 5777 |
Cytogenetics | 12p13.31 |
Summary | The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. N-terminal part of this PTP contains two tandem Src homolog (SH2) domains, which act as protein phospho-tyrosine binding domains, and mediate the interaction of this PTP with its substrates. This PTP is expressed primarily in hematopoietic cells, and functions as an important regulator of multiple signaling pathways in hematopoietic cells. This PTP has been shown to interact with, and dephosphorylate a wide spectrum of phospho-proteins involved in hematopoietic cell signaling. Multiple alternatively spliced variants of this gene, which encode distinct isoforms, have been reported. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Phosphatase, Stem cell - Pluripotency |
Protein Pathways | Adherens junction, B cell receptor signaling pathway, Jak-STAT signaling pathway, Natural killer cell mediated cytotoxicity, T cell receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401007 | PTPN6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC409133 | PTPN6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401007 | Transient overexpression lysate of protein tyrosine phosphatase, non-receptor type 6 (PTPN6), transcript variant 1 |
CNY 3,080.00 |
|
LY409133 | Transient overexpression lysate of protein tyrosine phosphatase, non-receptor type 6 (PTPN6), transcript variant 2 |
CNY 3,080.00 |
|
PH300728 | PTPN6 MS Standard C13 and N15-labeled recombinant protein (NP_536858) |
CNY 19,520.00 |
|
TP300728 | Recombinant protein of human protein tyrosine phosphatase, non-receptor type 6 (PTPN6), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP313896 | Recombinant protein of human protein tyrosine phosphatase, non-receptor type 6 (PTPN6), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP720146 | Recombinant protein of human protein tyrosine phosphatase, non-receptor type 6 (PTPN6), transcript variant 1 |
CNY 1,800.00 |