United States
Germany
Japan
United Kingdom
China
SHP1 (PTPN6) (NM_080548) Human Recombinant Protein
CAT＃: TP300728
Recombinant protein of human protein tyrosine phosphatase, non-receptor type 6 (PTPN6), transcript variant 2, 20 µg
View other "SHP1" proteins (8)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
| Cited in 1 publication. |
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC200728 protein sequence
Red=Cloning site Green=Tags(s) MLSRGWFHRDLSGLDAETLLKGRGVHGSFLARPSRKNQGDFSLSVRVGDQVTHIRIQNSGDFYDLYGGEK FATLTELVEYYTQQQGVLQDRDGTIIHLKYPLNCSDPTSERWYHGHMSGGQAETLLQAKGEPWTFLVRES LSQPGDFVLSVLSDQPKAGPGSPLRVTHIKVMCEGGRYTVGGLETFDSLTDLVEHFKKTGIEEASGAFVY LRQPYYATRVNAADIENRVLELNKKQESEDTAKAGFWEEFESLQKQEVKNLHQRLEGQRPENKGKNRYKN ILPFDHSRVILQGRDSNIPGSDYINANYIKNQLLGPDENAKTYIASQGCLEATVNDFWQMAWQENSRVIV MTTREVEKGRNKCVPYWPEVGMQRAYGPYSVTNCGEHDTTEYKLRTLQVSPLDNGDLIREIWHYQYLSWP DHGVPSEPGGVLSFLDQINQRQESLPHAGPIIVHCSAGIGRTGTIIVIDMLMENISTKGLDCDIDIQKTI QMVRAQRSGMVQTEAQYKFIYVAIAQFIETTKKKLEVLQSQKGQESEYGNITYPPAMKNAHAKASRTSSK HKEDVYENLHTKNKREEKVKKQRSADKEKSKGSLKRK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 67.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_536858 |
| Locus ID | 5777 |
| UniProt ID | P29350 |
| Refseq Size | 2234 |
| Cytogenetics | 12p13.31 |
| Refseq ORF | 1791 |
| Synonyms | HCP; HCPH; HPTP1C; PTP-1C; SH-PTP1; SHP-1; SHP-1L; SHP1 |
| Summary | The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. N-terminal part of this PTP contains two tandem Src homolog (SH2) domains, which act as protein phospho-tyrosine binding domains, and mediate the interaction of this PTP with its substrates. This PTP is expressed primarily in hematopoietic cells, and functions as an important regulator of multiple signaling pathways in hematopoietic cells. This PTP has been shown to interact with, and dephosphorylate a wide spectrum of phospho-proteins involved in hematopoietic cell signaling. Multiple alternatively spliced variants of this gene, which encode distinct isoforms, have been reported. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Phosphatase, Stem cell - Pluripotency |
| Protein Pathways | Adherens junction, B cell receptor signaling pathway, Jak-STAT signaling pathway, Natural killer cell mediated cytotoxicity, T cell receptor signaling pathway |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
JNK mediates mouse liver injury through a novel Sab (SH3BP5) dependent pathway leading to inactivation of intramitochondrial Src
,null,
Hepatology (Baltimore, Md.)
,PubMed ID 26845758
[PTPN6]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401007 | PTPN6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC409133 | PTPN6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401007 | Transient overexpression lysate of protein tyrosine phosphatase, non-receptor type 6 (PTPN6), transcript variant 1 |
CNY 3,080.00 |
|
| LY409133 | Transient overexpression lysate of protein tyrosine phosphatase, non-receptor type 6 (PTPN6), transcript variant 2 |
CNY 3,080.00 |
|
| PH300728 | PTPN6 MS Standard C13 and N15-labeled recombinant protein (NP_536858) |
CNY 19,520.00 |
|
| PH313896 | PTPN6 MS Standard C13 and N15-labeled recombinant protein (NP_002822) |
CNY 19,520.00 |
|
| TP313896 | Recombinant protein of human protein tyrosine phosphatase, non-receptor type 6 (PTPN6), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP720146 | Recombinant protein of human protein tyrosine phosphatase, non-receptor type 6 (PTPN6), transcript variant 1 |
CNY 3,140.00 |
