United States
Germany
Japan
United Kingdom
China
SEPTIN4 (NM_080415) Human Mass Spec Standard
CAT＃: PH315054
SEPT4 MS Standard C13 and N15-labeled recombinant protein (NP_536340)
View other "SEPTIN4" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
热销推荐Specifications
| Product Data | |
| Description | SEPT4 MS Standard C13 and N15-labeled recombinant protein (NP_536340) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC215054 |
| Predicted MW | 30.6 kDa |
| Protein Sequence |
>RC215054 representing NM_080415
Red=Cloning site Green=Tags(s) MIKRFLEDTTDDGELSKFVKDFSGNASCHPPEAKTWASRPQVPEPRPQAPDLYDDDLEFRPPSRPQSSDN QQYFCAPAPLSPSARPRSPWGKLDPYDSSEDDKEYVGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKST LVNSLFLTDLYRDRKLLGAEERIMQTVEITKHAVDIEEKGVRLRLTIVDTPGFGDAVNNTECWKPVAEYI DQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGYGPSLRLLAPPGAVKGTGQEHQGQGCH myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_536340 |
| RefSeq Size | 1911 |
| RefSeq ORF | 822 |
| Synonyms | ARTS; BRADEION; C17orf47; CE5B3; H5; hCDCREL-2; hucep-7; MART; PNUTL2; SEP4; SEPT4 |
| Locus ID | 5414 |
| Cytogenetics | 17q22 |
| Summary | This gene is a member of the septin family of nucleotide binding proteins, originally described in yeast as cell division cycle regulatory proteins. Septins are highly conserved in yeast, Drosophila, and mouse, and appear to regulate cytoskeletal organization. Disruption of septin function disturbs cytokinesis and results in large multinucleate or polyploid cells. This gene is highly expressed in brain and heart. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. One of the isoforms (known as ARTS) is distinct; it is localized to the mitochondria, and has a role in apoptosis and cancer. [provided by RefSeq, Nov 2010] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401449 | 42251 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC403307 | 42251 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC403308 | 42251 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC434256 | 42251 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401449 | Transient overexpression lysate of septin 4 (SEPT4), transcript variant 1 |
CNY 4,840.00 |
|
| LY403307 | Transient overexpression lysate of septin 4 (SEPT4), transcript variant 2 |
CNY 3,080.00 |
|
| LY403308 | Transient overexpression lysate of septin 4 (SEPT4), transcript variant 3 |
CNY 3,080.00 |
|
| LY434256 | Transient overexpression lysate of septin 4 (SEPT4), transcript variant 4 |
CNY 3,080.00 |
|
| PH313106 | SEPT4 MS Standard C13 and N15-labeled recombinant protein (NP_004565) |
CNY 19,520.00 |
|
| TP313106 | Recombinant protein of human septin 4 (SEPT4), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP315054 | Recombinant protein of human septin 4 (SEPT4), transcript variant 2, 20 µg |
CNY 2,900.00 |
其它SEPTIN4产品
