SEPTIN4 (NM_080415) Human Recombinant Protein
CAT#: TP315054
Recombinant protein of human septin 4 (SEPT4), transcript variant 2, 20 µg
View other "SEPTIN4" proteins (11)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC215054 representing NM_080415
Red=Cloning site Green=Tags(s) MIKRFLEDTTDDGELSKFVKDFSGNASCHPPEAKTWASRPQVPEPRPQAPDLYDDDLEFRPPSRPQSSDN QQYFCAPAPLSPSARPRSPWGKLDPYDSSEDDKEYVGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKST LVNSLFLTDLYRDRKLLGAEERIMQTVEITKHAVDIEEKGVRLRLTIVDTPGFGDAVNNTECWKPVAEYI DQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGYGPSLRLLAPPGAVKGTGQEHQGQGCH myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 30.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_536340 |
Locus ID | 5414 |
UniProt ID | O43236, Q8NEP4 |
Refseq Size | 1911 |
Cytogenetics | 17q22 |
Refseq ORF | 822 |
Synonyms | ARTS; BRADEION; C17orf47; CE5B3; H5; hCDCREL-2; hucep-7; MART; PNUTL2; SEP4; SEPT4 |
Summary | This gene is a member of the septin family of nucleotide binding proteins, originally described in yeast as cell division cycle regulatory proteins. Septins are highly conserved in yeast, Drosophila, and mouse, and appear to regulate cytoskeletal organization. Disruption of septin function disturbs cytokinesis and results in large multinucleate or polyploid cells. This gene is highly expressed in brain and heart. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. One of the isoforms (known as ARTS) is distinct; it is localized to the mitochondria, and has a role in apoptosis and cancer. [provided by RefSeq, Nov 2010] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401449 | 42251 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC403307 | 42251 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC403308 | 42251 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC434256 | 42251 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401449 | Transient overexpression lysate of septin 4 (SEPT4), transcript variant 1 |
CNY 4,840.00 |
|
LY403307 | Transient overexpression lysate of septin 4 (SEPT4), transcript variant 2 |
CNY 3,080.00 |
|
LY403308 | Transient overexpression lysate of septin 4 (SEPT4), transcript variant 3 |
CNY 3,080.00 |
|
LY434256 | Transient overexpression lysate of septin 4 (SEPT4), transcript variant 4 |
CNY 3,080.00 |
|
PH313106 | SEPT4 MS Standard C13 and N15-labeled recombinant protein (NP_004565) |
CNY 19,520.00 |
|
PH315054 | SEPT4 MS Standard C13 and N15-labeled recombinant protein (NP_536340) |
CNY 19,520.00 |
|
TP313106 | Recombinant protein of human septin 4 (SEPT4), transcript variant 1, 20 µg |
CNY 2,900.00 |
其它SEPTIN4产品