United States
Germany
Japan
United Kingdom
China
PML Protein (PML) (NM_033246) Human Mass Spec Standard
CAT＃: PH320522
PML MS Standard C13 and N15-labeled recombinant protein (NP_150249)
View other "PML Protein" proteins (15)
|
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Product images
Specifications
| Product Data | |
| Description | PML MS Standard C13 and N15-labeled recombinant protein (NP_150249) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC220522 |
| Predicted MW | 47.4 kDa |
| Protein Sequence |
>RC220522 representing NM_033246
Red=Cloning site Green=Tags(s) MEPAPARSPRPQQDPARPQEPTMPPPETPSEGRQPSPSPSPTERAPASEEEFQFLRCQQCQAEAKCPKLL PCLHTLCSGCLEASGMQCPICQAPWPLGADTPALDNVFFESLQRRLSVYRQIVDAQAVCTRCKESADFWC FECEQLLCAKCFEAHQWFLKHEARPLAELRNQSVREFLDGTRKTNNIFCSNPNHRTPTLTSIYCRGCSKP LCCSCALLDSSHSELKCDISAEIQQRQEELDAMTQALQEQDSAFGAVHAQMHAAVGQLGRARAETEELIR ERVRQVVAHVRAQERELLEAVDARYQRDYEEMASRLGRLDAVLQRIRTGSALVQRMKCYASDQEVLDMHG FLRQALCRLRQEEPQSLQAAVRTDGFDEFKVRLQDLSSCITQGKDAAVSKKASPEAASTPRDPIDVDLRN ALW SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_150249 |
| RefSeq Size | 1851 |
| RefSeq ORF | 1269 |
| Synonyms | MYL; PP8675; RNF71; TRIM19 |
| Locus ID | 5371 |
| Cytogenetics | 15q24.1 |
| Summary | The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This phosphoprotein localizes to nuclear bodies where it functions as a transcription factor and tumor suppressor. Its expression is cell-cycle related and it regulates the p53 response to oncogenic signals. The gene is often involved in the translocation with the retinoic acid receptor alpha gene associated with acute promyelocytic leukemia (APL). Extensive alternative splicing of this gene results in several variations of the protein's central and C-terminal regions; all variants encode the same N-terminus. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Transcription Factors |
| Protein Pathways | Acute myeloid leukemia, Pathways in cancer, Ubiquitin mediated proteolysis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409649 | PML HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC409651 | PML HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC409652 | PML HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC409653 | PML HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC409655 | PML HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409649 | Transient overexpression lysate of promyelocytic leukemia (PML), transcript variant 9 |
CNY 4,840.00 |
|
| LY409651 | Transient overexpression lysate of promyelocytic leukemia (PML), transcript variant 5 |
CNY 4,840.00 |
|
| LY409652 | Transient overexpression lysate of promyelocytic leukemia (PML), transcript variant 7 |
CNY 4,840.00 |
|
| LY409653 | Transient overexpression lysate of promyelocytic leukemia (PML), transcript variant 8 |
CNY 4,840.00 |
|
| LY409655 | Transient overexpression lysate of promyelocytic leukemia (PML), transcript variant 11 |
CNY 3,080.00 |
|
| PH312067 | PML MS Standard C13 and N15-labeled recombinant protein (NP_150242) |
CNY 19,520.00 |
|
| PH320236 | PML MS Standard C13 and N15-labeled recombinant protein (NP_150247) |
CNY 14,250.00 |
|
| TP312067 | Recombinant protein of human promyelocytic leukemia (PML), transcript variant 9, 20 µg |
CNY 2,900.00 |
|
| TP320236 | Recombinant protein of human promyelocytic leukemia (PML), transcript variant 5, 20 µg |
CNY 2,900.00 |
|
| TP320522 | Purified recombinant protein of Homo sapiens promyelocytic leukemia (PML), transcript variant 7, 20 µg |
CNY 2,900.00 |
其它PML Protein产品
