MRPS7 (NM_015971) Human Recombinant Protein
CAT#: TP300031
Recombinant protein of human mitochondrial ribosomal protein S7 (MRPS7), nuclear gene encoding mitochondrial protein, 20 µg
View other "MRPS7" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200031 protein sequence
Red=Cloning site Green=Tags(s) MVAPAVKVARGWSGLALGVRRAVLQLPGLTQVRWSRYSPEFKDPLIDKEYYRKPVEELTEEEKYVRELKK TQLIKAAPAGKTSSVFEDPVISKFTNMMMIGGNKVLARSLMIQTLEAVKRKQFEKYHAASAEEQATIERN PYTIFHQALKNCEPMIGLVPILKGGRFYQVPVPLPDRRRRFLAMKWMITECRDKKHQRTLMPEKLSHKLL EAFHNQGPVIKRKHDLHKMAEANRALAHYRWW myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 28 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057055 |
Locus ID | 51081 |
UniProt ID | Q9Y2R9 |
Refseq Size | 1432 |
Cytogenetics | 17q25.1 |
Refseq ORF | 726 |
Synonyms | bMRP27a; COXPD34; MRP-S; MRP-S7; RP-S7; RPMS7; S7mt |
Summary | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein. In the prokaryotic ribosome, the comparable protein is thought to play an essential role in organizing the 3' domain of the 16 S rRNA in the vicinity of the P- and A-sites. Pseudogenes corresponding to this gene are found on chromosomes 8p and 12p. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414276 | MRPS7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414276 | Transient overexpression lysate of mitochondrial ribosomal protein S7 (MRPS7), nuclear gene encoding mitochondrial protein |
CNY 3,080.00 |
|
PH300031 | MRPS7 MS Standard C13 and N15-labeled recombinant protein (NP_057055) |
CNY 19,520.00 |