ROC1 (RBX1) (NM_014248) Human Recombinant Protein
CAT#: TP300348
Recombinant protein of human ring-box 1 (RBX1), 20 µg
View other "ROC1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200348 protein sequence
Red=Cloning site Green=Tags(s) MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTV AWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 12.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_055063 |
Locus ID | 9978 |
UniProt ID | P62877 |
Refseq Size | 906 |
Cytogenetics | 22q13.2 |
Refseq ORF | 324 |
Synonyms | BA554C12.1; RNF75; ROC1 |
Summary | This locus encodes a RING finger-like domain-containing protein. The encoded protein interacts with cullin proteins and likely plays a role in ubiquitination processes necessary for cell cycle progression. This protein may also affect protein turnover. Related pseudogenes exist on chromosomes 2 and 5.[provided by RefSeq, Sep 2010] |
Protein Families | Druggable Genome |
Protein Pathways | Cell cycle, Nucleotide excision repair, Oocyte meiosis, Pathways in cancer, Renal cell carcinoma, TGF-beta signaling pathway, Ubiquitin mediated proteolysis, Wnt signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |