FCGRT (NM_004107) Human Recombinant Protein
CAT#: TP300364
Recombinant protein of human Fc fragment of IgG, receptor, transporter, alpha (FCGRT), transcript variant 1, 20 µg
View other "FCGRT" proteins (8)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 2 publications. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200364 representing NM_004107
Red=Cloning site Green=Tags(s) MGVPRPQPWALGLLLFLLPGSLGAESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEP CGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEF MNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKAR PSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHA GLAQPLRVELESPAKSSVLVVGIVIGVLLLTAAAVGGALLWRRMRSGLPAPWISLRGDDTGVLLPTPGEA QDADLKDVNVIPATA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 39.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | MS digestion standard (PMID: 27012525) MS digestion standard (PMID: 27232760) |
Reference Data | |
RefSeq | NP_004098 |
Locus ID | 2217 |
UniProt ID | P55899 |
Refseq Size | 1510 |
Cytogenetics | 19q13.33 |
Refseq ORF | 1095 |
Synonyms | alpha-chain; FCRN |
Summary | This gene encodes a receptor that binds the Fc region of monomeric immunoglobulin G. The encoded protein transfers immunoglobulin G antibodies from mother to fetus across the placenta. This protein also binds immunoglobulin G to protect the antibody from degradation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2009] |
Protein Families | Transmembrane |
Citations (2)
The use of this Proteins has been cited in the following citations: |
---|
Utility of a human FcRn transgenic mouse model in drug discovery for early assessment and prediction of human pharmacokinetics of monoclonal antibodies
,Avery, LB;Wang, M;Kavosi, MS;Joyce, A;Kurz, JC;Fan, YY;Dowty, ME;Zhang, M;Zhang, Y;Cheng, A;Hua, F;Jones, HM;Neubert, H;Polzer, RJ;O'Hara, DM;,
MAbs
,PubMed ID 27232760
[FCGRT]
|
Quantitative analysis of human neonatal Fc receptor (FcRn) tissue expression in transgenic mice by online peptide immuno-affinity LC-HRMS
,Fan, YY;Neubert, H;,
Anal. Chem.
,PubMed ID 27012525
[FCGRT]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401327 | FCGRT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427768 | FCGRT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401327 | Transient overexpression lysate of Fc fragment of IgG, receptor, transporter, alpha (FCGRT), transcript variant 2 |
CNY 3,080.00 |
|
LY427768 | Transient overexpression lysate of Fc fragment of IgG, receptor, transporter, alpha (FCGRT), transcript variant 1 |
CNY 3,080.00 |
|
PH300364 | FCGRT MS Standard C13 and N15-labeled recombinant protein (NP_004098) |
CNY 19,520.00 |
|
PH327329 | FCGRT MS Standard C13 and N15-labeled recombinant protein (NP_001129491) |
CNY 19,520.00 |
|
TP327329 | Recombinant protein of human Fc fragment of IgG, receptor, transporter, alpha (FCGRT), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP721216 | Purified recombinant protein of Human Fc fragment of IgG, receptor, transporter, alpha (FCGRT), transcript variant 2 |
CNY 3,140.00 |