GSK3 beta (GSK3B) (NM_002093) Human Recombinant Protein
CAT#: TP300468L
Recombinant protein of human glycogen synthase kinase 3 beta (GSK3B), 1 mg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 36,000.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200468 representing NM_002093
Red=Cloning site Green=Tags(s) MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVV YQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVY RVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRG EPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQ IREMNPNYTEFKFPQIKAHPWTKDSSGTGHFTSGVRVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAH SFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQ TNNAASASASNST myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 47.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002084 |
Locus ID | 2932 |
UniProt ID | P49841 |
Refseq Size | 1639 |
Cytogenetics | 3q13.33 |
Refseq ORF | 1299 |
Summary | The protein encoded by this gene is a serine-threonine kinase belonging to the glycogen synthase kinase subfamily. It is a negative regulator of glucose homeostasis and is involved in energy metabolism, inflammation, ER-stress, mitochondrial dysfunction, and apoptotic pathways. Defects in this gene have been associated with Parkinson disease and Alzheimer disease. [provided by RefSeq, Aug 2017] |
Protein Families | Druggable Genome, Protein Kinase |
Protein Pathways | Alzheimer's disease, Axon guidance, Basal cell carcinoma, B cell receptor signaling pathway, Cell cycle, Chemokine signaling pathway, Colorectal cancer, Endometrial cancer, ErbB signaling pathway, Focal adhesion, Hedgehog signaling pathway, Insulin signaling pathway, Melanogenesis, Neurotrophin signaling pathway, Pathways in cancer, Prostate cancer, T cell receptor signaling pathway, Wnt signaling pathway |
Documents
FAQs |
SDS |
其它GSK3 beta产品