BCAT2 (NM_001190) Human Recombinant Protein
CAT#: TP300625
Recombinant protein of human branched chain aminotransferase 2, mitochondrial (BCAT2), nuclear gene encoding mitochondrial protein, 20 µg
View other "BCAT2" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200625 protein sequence
Red=Cloning site Green=Tags(s) MAAAALGQIWARKLLSVPWLLCGPRRYASSSFKAADLQLEMTQKPHKKPGPGEPLVFGKTFTDHMLMVEW NDKGWGQPRIQPFQNLTLHPASSSLHYSLQLFEGMKAFKGKDQQVRLFRPWLNMDRMLRSAMRLCLPSFD KLELLECIRRLIEVDKDWVPDAAGTSLYVRPVLIGNEPSLGVSQPTRALLFVILCPVGAYFPGGSVTPVS LLADPAFIRAWVGGVGNYKLGGNYGPTVLVQQEALKRGCEQVLWLYGPDHQLTEVGTMNIFVYWTHEDGV LELVTPPLNGVILPGVVRQSLLDMAQTWGEFRVVERTITMKQLLRALEEGRVREVFGSGTACQVCPVHRI LYKDRNLHIPTMENGPELILRFQKELKEIQYGIRAHEWMFPV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 41.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001181 |
Locus ID | 587 |
UniProt ID | O15382 |
Refseq Size | 1616 |
Cytogenetics | 19q13.33 |
Refseq ORF | 1176 |
Synonyms | BCAM; BCATM; BCT2; HVLI; PP18 |
Summary | This gene encodes a branched chain aminotransferase found in mitochondria. The encoded protein forms a dimer that catalyzes the first step in the production of the branched chain amino acids leucine, isoleucine, and valine. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2009] |
Protein Families | Druggable Genome |
Protein Pathways | Metabolic pathways, Pantothenate and CoA biosynthesis, Valine, leucine and isoleucine biosynthesis, Valine, leucine and isoleucine degradation |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400477 | BCAT2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400477 | Transient overexpression lysate of branched chain aminotransferase 2, mitochondrial (BCAT2), nuclear gene encoding mitochondrial protein, transcript variant a |
CNY 3,080.00 |
|
PH300625 | BCAT2 MS Standard C13 and N15-labeled recombinant protein (NP_001181) |
CNY 19,520.00 |