United States
Germany
Japan
United Kingdom
China
BAD (NM_004322) Human Recombinant Protein
CAT＃: TP300634
Recombinant protein of human BCL2-associated agonist of cell death (BAD), transcript variant 1, 20 µg
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC200634 representing NM_004322
Red=Cloning site Green=Tags(s) MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVEIR SRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQ MRQSSSWTRVFQSWWDRNLGRGSSAPSQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 18.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_004313 |
| Locus ID | 572 |
| UniProt ID | Q92934 |
| Refseq Size | 1127 |
| Cytogenetics | 11q13.1 |
| Refseq ORF | 504 |
| Synonyms | BBC2; BCL2L8 |
| Summary | The protein encoded by this gene is a member of the BCL-2 family. BCL-2 family members are known to be regulators of programmed cell death. This protein positively regulates cell apoptosis by forming heterodimers with BCL-xL (B-cell lymphoma-extra large) and BCL-2, and reversing their death repressor activity. Proapoptotic activity of this protein is regulated through its phosphorylation. Protein kinases AKT and MAP kinase, as well as protein phosphatase calcineurin were found to be involved in the regulation of this protein. Alternative splicing of this gene results in two transcript variants which encode the same isoform. [provided by RefSeq, Dec 2019] |
| Protein Families | Druggable Genome |
| Protein Pathways | Acute myeloid leukemia, Alzheimer's disease, Amyotrophic lateral sclerosis (ALS), Apoptosis, Chronic myeloid leukemia, Colorectal cancer, Endometrial cancer, ErbB signaling pathway, Focal adhesion, Insulin signaling pathway, Melanoma, Neurotrophin signaling pathway, Non-small cell lung cancer, Pancreatic cancer, Pathways in cancer, Prostate cancer, VEGF signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403214 | BAD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC418067 | BAD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC429193 | BAD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403214 | Transient overexpression lysate of BCL2-associated agonist of cell death (BAD), transcript variant 2 |
CNY 3,080.00 |
|
| LY418067 | Transient overexpression lysate of BCL2-associated agonist of cell death (BAD), transcript variant 1 |
CNY 3,080.00 |
|
| LY429193 | Transient overexpression lysate of BCL2-associated agonist of cell death (BAD), transcript variant 1 |
CNY 3,080.00 |
|
| PH300634 | BAD MS Standard C13 and N15-labeled recombinant protein (NP_004313) |
CNY 19,520.00 |
|
| TP760222 | Recombinant protein of human BCL2-associated agonist of cell death (BAD), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |
