Syntaxin 3 (STX3) (NM_004177) Human Recombinant Protein
CAT#: TP300658
Recombinant protein of human syntaxin 3 (STX3), 20 µg
View other "Syntaxin 3" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200658 protein sequence
Red=Cloning site Green=Tags(s) MKDRLEQLKAKQLTQDDDTDAVEIAIDNTAFMDEFFSEIEETRLNIDKISEHVEEAKKLYSIILSAPIPE PKTKDDLEQLTTEIKKRANNVRNKLKSMEKHIEEDEVRSSADLRIRKSQHSVLSRKFVEVMTKYNEAQVD FRERSKGRIQRQLEITGKKTTDEELEEMLESGNPAIFTSGIIDSQISKQALSEIEGRHKDIVRLESSIKE LHDMFMDIAMLVENQGEMLDNIELNVMHTVDHVEKARDETKKAVKYQSQARKKLIIIIVLVVVLLGILAL IIGLSVGLN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 33 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004168 |
Locus ID | 6809 |
UniProt ID | Q13277 |
Refseq Size | 6498 |
Cytogenetics | 11q12.1 |
Refseq ORF | 867 |
Synonyms | STX3A |
Summary | The gene is a member of the syntaxin family. The encoded protein is targeted to the apical membrane of epithelial cells where it forms clusters and is important in establishing and maintaining polarity necessary for protein trafficking involving vesicle fusion and exocytosis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2010] |
Protein Families | Druggable Genome, Stem cell - Pluripotency, Transmembrane |
Protein Pathways | SNARE interactions in vesicular transport |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418166 | STX3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC432811 | STX3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418166 | Transient overexpression lysate of syntaxin 3 (STX3) |
CNY 3,080.00 |
|
LY432811 | Transient overexpression lysate of syntaxin 3 (STX3), transcript variant 2 |
CNY 3,080.00 |
|
PH300658 | STX3 MS Standard C13 and N15-labeled recombinant protein (NP_004168) |
CNY 19,520.00 |
其它Syntaxin 3产品