United States
Germany
Japan
United Kingdom
China
PPP2R4 (PTPA) (NM_178000) Human Recombinant Protein
CAT＃: TP300671
Recombinant protein of human protein phosphatase 2A activator, regulatory subunit 4 (PPP2R4), transcript variant 2, 20 µg
View other "PPP2R4" proteins (12)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC200671 protein sequence
Red=Cloning site Green=Tags(s) MAEGERQPPPDSSEEAPPATQNFIIPKKEIHTVPDMGKWKRSQAYADYIGFILTLNEGVKGKKLTFEYRV SEAIEKLVALLNTLDRWIDETPPVDQPSRFGNKAYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLK ESVGNSTRIDYGTGHEAAFAAFLCCLCKIGVLRVDDQIAIVFKVFNRYLEVMRKLQKTYRMEPAGSQGVW GLDDFQFLPFIWGSSQLIDHPYLEPRHFVDEKAVNENHKDYMFLECILFITEMKTGPFAEHSNQLWNISA VPSWSKVNQGLIRMYKAECLEKFPVIQHFKFGSLLPIHPVTSG myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 36.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_821067 |
| Locus ID | 5524 |
| UniProt ID | Q15257 |
| Refseq Size | 2764 |
| Cytogenetics | 9q34.11 |
| Refseq ORF | 969 |
| Synonyms | PP2A; PPP2R4; PR53 |
| Summary | Protein phosphatase 2A is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division. Protein phosphatase 2A holoenzymes are heterotrimeric proteins composed of a structural subunit A, a catalytic subunit C, and a regulatory subunit B. The regulatory subunit is encoded by a diverse set of genes that have been grouped into the B/PR55, B'/PR61, and B''/PR72 families. These different regulatory subunits confer distinct enzymatic specificities and intracellular localizations to the holozenzyme. The product of this gene belongs to the B' family. This gene encodes a specific phosphotyrosyl phosphatase activator of the dimeric form of protein phosphatase 2A. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Phosphatase |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406041 | PPP2R4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC406042 | PPP2R4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC406043 | PPP2R4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC412071 | PPP2R4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC429647 | PPP2R4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY406041 | Transient overexpression lysate of protein phosphatase 2A activator, regulatory subunit 4 (PPP2R4), transcript variant 2 |
CNY 3,080.00 |
|
| LY406042 | Transient overexpression lysate of protein phosphatase 2A activator, regulatory subunit 4 (PPP2R4), transcript variant 1 |
CNY 3,080.00 |
|
| LY406043 | Transient overexpression lysate of protein phosphatase 2A activator, regulatory subunit 4 (PPP2R4), transcript variant 5 |
CNY 3,080.00 |
|
| LY412071 | Transient overexpression lysate of protein phosphatase 2A activator, regulatory subunit 4 (PPP2R4), transcript variant 3 |
CNY 3,080.00 |
|
| PH300671 | PPP2R4 MS Standard C13 and N15-labeled recombinant protein (NP_821067) |
CNY 19,520.00 |
|
| PH312144 | PPP2R4 MS Standard C13 and N15-labeled recombinant protein (NP_066954) |
CNY 19,520.00 |
|
| TP312144 | Recombinant protein of human protein phosphatase 2A activator, regulatory subunit 4 (PPP2R4), transcript variant 3, 20 µg |
CNY 2,900.00 |
Rabbit anti-PPP2R4 Polyclonal Antibody
热销推荐
