ICAM1 (NM_000201) Human Recombinant Protein
CAT#: TP300714
Purified recombinant protein of Homo sapiens intercellular adhesion molecule 1 (ICAM1), 20 µg
View other "ICAM1" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200714 representing NM_000201
Red=Cloning site Green=Tags(s) MAPSSPRPALPALLVLLGALFPGPGNAQTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELL LPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAPLPSWQPVGKNLTLRCQVEGG APRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHHGANFSCRTELDLRPQGLELFENTSAPYQLQ TFVLPATPPQLVSPRVLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTA EDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPL GPRAQLLLKATPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQ AWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTREVTVNVLSPRYEIVIITVVAAA VIMGTAGLSTYLYNRQRKIKKYRLQQAQKGTPMKPNTQATPP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 55.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000192 |
Locus ID | 3383 |
UniProt ID | P05362 |
Refseq Size | 2986 |
Cytogenetics | 19p13.2 |
Refseq ORF | 1596 |
Synonyms | BB2; CD54; P3.58 |
Summary | This gene encodes a cell surface glycoprotein which is typically expressed on endothelial cells and cells of the immune system. It binds to integrins of type CD11a / CD18, or CD11b / CD18 and is also exploited by Rhinovirus as a receptor. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Transmembrane |
Protein Pathways | Cell adhesion molecules (CAMs), Leukocyte transendothelial migration, Natural killer cell mediated cytotoxicity, Viral myocarditis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400073 | ICAM1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400073 | Transient overexpression lysate of intercellular adhesion molecule 1 (ICAM1) |
CNY 3,080.00 |
|
PH300714 | ICAM1 MS Standard C13 and N15-labeled recombinant protein (NP_000192) |
CNY 14,250.00 |
|
TP720283 | Recombinant protein of human intercellular adhesion molecule 1 (ICAM1) |
CNY 3,140.00 |
|
TP721375 | Recombinant mouse ICAM-1/CD54 protein |
CNY 1,313.00 |
|
TP723972 | Human ICAM-1 Protein, mFc Tag |
CNY 5,249.00 |