KATNAL1 (NM_032116) Human Recombinant Protein
CAT#: TP300828
Recombinant protein of human katanin p60 subunit A-like 1 (KATNAL1), transcript variant 1, 20 µg
View other "KATNAL1" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200828 protein sequence
Red=Cloning site Green=Tags(s) MNLAEICDNAKKGREYALLGNYDSSMVYYQGVMQQIQRHCQSVRDPAIKGKWQQVRQELLEEYEQVKSIV STLESFKIDKPPDFPVSCQDEPFRDPAVWPPPVPAEHRAPPQIRRPNREVRPLRKEMAGVGARGPVGRAH PISKSEKPSTSRDKDYRARGRDDKGRKNMQDGASDGEMPKFDGAGYDKDLVEALERDIVSRNPSIHWDDI ADLEEAKKLLREAVVLPMWMPDFFKGIRRPWKGVLMVGPPGTGKTMLAKAVATECGTTFFNVSSSTLTSK YRGESEKLVRLLFEMARFYAPTTIFIDEIDSICSRRGTSDEHEASRRVKSELLIQMDGVGGALENDDPSK MVMVLAATNFPWDIDEALRRRLEKRIYIPLPTAKGRAELLKINLREVELDPDIQLEDIAEKIEGYSGADI TNVCRDASLMAMRRRINGLSPEEIRALSKEELQMPVTKGDFELALKKIAKSVSAADLEKYEKWMVEFGSA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 55.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_115492 |
Locus ID | 84056 |
UniProt ID | Q9BW62 |
Refseq Size | 7554 |
Cytogenetics | 13q12.3 |
Refseq ORF | 1470 |
Summary | Regulates microtubule dynamics in Sertoli cells, a process that is essential for spermiogenesis and male fertility. Severs microtubules in an ATP-dependent manner, promoting rapid reorganization of cellular microtubule arrays (By similarity). Has microtubule-severing activity in vitro (PubMed:26929214).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403145 | KATNAL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423055 | KATNAL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY403145 | Transient overexpression lysate of katanin p60 subunit A-like 1 (KATNAL1), transcript variant 1 |
CNY 3,080.00 |
|
LY423055 | Transient overexpression lysate of katanin p60 subunit A-like 1 (KATNAL1), transcript variant 2 |
CNY 4,840.00 |
|
PH300828 | KATNAL1 MS Standard C13 and N15-labeled recombinant protein (NP_115492) |
CNY 19,520.00 |
|
PH320944 | KATNAL1 MS Standard C13 and N15-labeled recombinant protein (NP_001014402) |
CNY 19,520.00 |
|
TP320944 | Recombinant protein of human katanin p60 subunit A-like 1 (KATNAL1), transcript variant 2, 20 µg |
CNY 2,900.00 |
其它KATNAL1产品