United States
Germany
Japan
United Kingdom
China
GIPC (GIPC1) (NM_202470) Human Recombinant Protein
CAT＃: TP301175
Recombinant protein of human GIPC PDZ domain containing family, member 1 (GIPC1), transcript variant 5, 20 µg
View other "GIPC" proteins (11)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 1,999.00
CNY 2,700.00
热销推荐CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201175 protein sequence
Red=Cloning site Green=Tags(s) MPLGLGRRKKAPPLVENEEAEPGRGGLGVGEPGPLGGGGSGGPQMGLPPPPPALRPRLVFHTQLAHGSPT GRIEGFTNVKELYGKIAEAFRLPTAEVMFCTLNTHKVDMDKLLGGQIGLEDFIFAHVKGQRKEVEVFKSE DALGLTITDNGAGYAFIKRIKEGSVIDHIHLISVGDMIEAINGQSLLGCRHYEVARLLKELPRGRTFTLK LTEPRKAFDMISQRSAGGRPGSGPQLGTGRGTLRLRSRGPATVEDLPSAFEEKAIEKVDDLLESYMGIRD TELAATMVELGKDKRNPDELAEALDERLGDFAFPDEFVFDVWGAIGDAKVGRY myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 35.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_974199 |
| Locus ID | 10755 |
| UniProt ID | O14908 |
| Refseq Size | 1820 |
| Cytogenetics | 19p13.12 |
| Refseq ORF | 999 |
| Synonyms | C19orf3; GIPC; GLUT1CBP; Hs.6454; IIP-1; NIP; OPDM2; RGS19IP1; SEMCAP; SYNECTIIN; SYNECTIN; TIP-2 |
| Summary | GIPC1 is a scaffolding protein that regulates cell surface receptor expression and trafficking (Lee et al., 2008 [PubMed 18775991]).[supplied by OMIM, Apr 2009] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404361 | GIPC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404363 | GIPC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC417114 | GIPC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY404361 | Transient overexpression lysate of GIPC PDZ domain containing family, member 1 (GIPC1), transcript variant 3 |
CNY 3,080.00 |
|
| LY404363 | Transient overexpression lysate of GIPC PDZ domain containing family, member 1 (GIPC1), transcript variant 5 |
CNY 3,080.00 |
|
| LY417114 | Transient overexpression lysate of GIPC PDZ domain containing family, member 1 (GIPC1), transcript variant 1 |
CNY 3,080.00 |
|
| PH301175 | GIPC1 MS Standard C13 and N15-labeled recombinant protein (NP_974199) |
CNY 19,520.00 |
|
| PH316466 | GIPC1 MS Standard C13 and N15-labeled recombinant protein (NP_005707) |
CNY 19,520.00 |
|
| PH324373 | GIPC1 MS Standard C13 and N15-labeled recombinant protein (NP_974197) |
CNY 19,520.00 |
|
| TP316466 | Recombinant protein of human GIPC PDZ domain containing family, member 1 (GIPC1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP324373 | Recombinant protein of human GIPC PDZ domain containing family, member 1 (GIPC1), transcript variant 3, 20 µg |
CNY 2,900.00 |
GIPC1 mouse monoclonal antibody,clone OTI4C11
