MAL (NM_002371) Human Recombinant Protein
CAT#: TP301256
Recombinant protein of human mal, T-cell differentiation protein (MAL), transcript variant a, 20 µg
View other "MAL" proteins (11)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201256 protein sequence
Red=Cloning site Green=Tags(s) MAPAAATGGSTLPSGFSVFTTLPDLLFIFEFIFGGLVWILVASSLVPWPLVQGWVMFVSVFCFVATTTLI ILYIIGAHGGETSWVTLDAAYHCTAALFYLSASVLEALATITMQDGFTYRHYHENIAAVVFSYIATLLYV VHAVFSLIRWKSS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 16.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002362 |
Locus ID | 4118 |
UniProt ID | P21145, A0A024RE19 |
Refseq Size | 1153 |
Cytogenetics | 2q11.1 |
Refseq ORF | 459 |
Synonyms | MVP17; VIP17 |
Summary | The protein encoded by this gene is a highly hydrophobic integral membrane protein belonging to the MAL family of proteolipids. The protein has been localized to the endoplasmic reticulum of T-cells and is a candidate linker protein in T-cell signal transduction. In addition, this proteolipid is localized in compact myelin of cells in the nervous system and has been implicated in myelin biogenesis and/or function. The protein plays a role in the formation, stabilization and maintenance of glycosphingolipid-enriched membrane microdomains. Down-regulation of this gene has been associated with a variety of human epithelial malignancies. Alternative splicing produces four transcript variants which vary from each other by the presence or absence of alternatively spliced exons 2 and 3. [provided by RefSeq, May 2012] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400850 | MAL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC411702 | MAL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC411704 | MAL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400850 | Transient overexpression lysate of mal, T-cell differentiation protein (MAL), transcript variant a |
CNY 3,080.00 |
|
LY411702 | Transient overexpression lysate of mal, T-cell differentiation protein (MAL), transcript variant b |
CNY 3,080.00 |
|
LY411704 | Transient overexpression lysate of mal, T-cell differentiation protein (MAL), transcript variant d |
CNY 3,080.00 |
|
PH301256 | MAL MS Standard C13 and N15-labeled recombinant protein (NP_002362) |
CNY 19,520.00 |
|
PH311612 | MAL MS Standard C13 and N15-labeled recombinant protein (NP_071885) |
CNY 19,520.00 |
|
PH317248 | MAL MS Standard C13 and N15-labeled recombinant protein (NP_071883) |
CNY 19,520.00 |
|
TP311612 | Recombinant protein of human mal, T-cell differentiation protein (MAL), transcript variant d, 20 µg |
CNY 2,900.00 |
|
TP317248 | Recombinant protein of human mal, T-cell differentiation protein (MAL), transcript variant b, 20 µg |
CNY 2,900.00 |