PA1 (PAGR1) (NM_024516) Human Recombinant Protein
CAT#: TP301417
Recombinant protein of human chromosome 16 open reading frame 53 (C16orf53), 20 µg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201417 protein sequence
Red=Cloning site Green=Tags(s) MSLARGHGDTAASTAAPLSEEGEVTSGLQALAVEDTGGPSASAGKAEDEGEGGREETEREGSGGEEAQGE VPSAGGEEPAEEDSEDWCVPCSDEEVELPADGQPWMPPPSEIQRLYELLAAHGTLELQAEILPRRPPTPE AQSEEERSDEEPEAKEEEEEKPHMPTEFDFDDEPVTPKDSLIDRRRTPGSSARSQKREARLDKVLSDMKR HKKLEEQILRTGRDLFSLDSEDPSPASPPLRSSGSSLFPRQRKY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 27.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_078792 |
Locus ID | 79447 |
UniProt ID | Q9BTK6 |
Refseq Size | 3843 |
Cytogenetics | 16p11.2 |
Refseq ORF | 762 |
Synonyms | C16orf53; GAS; PA1 |
Summary | C16ORF53 (PA1) is a component of a Set1-like multiprotein histone methyltransferase complex (Cho et al., 2007 [PubMed 17500065]).[supplied by OMIM, May 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411261 | PAGR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411261 | Transient overexpression lysate of chromosome 16 open reading frame 53 (C16orf53) |
CNY 3,080.00 |
|
PH301417 | C16orf53 MS Standard C13 and N15-labeled recombinant protein (NP_078792) |
CNY 19,520.00 |