SAR1 (SAR1A) (NM_020150) Human Recombinant Protein
CAT#: TP301450
Recombinant protein of human SAR1 homolog A (S. cerevisiae) (SAR1A), transcript variant 2, 20 µg
View other "SAR1" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201450 protein sequence
Red=Cloning site Green=Tags(s) MSFIFEWIYNGFSSVLQFLGLYKKSGKLVFLGLDNAGKTTLLHMLKDDRLGQHVPTLHPTSEELTIAGMT FTTFDLGGHEQARRVWKNYLPAINGIVFLVDCADHSRLVESKVELNALMTDETISNVPILILGNKIDRTD AISEEKLREIFGLYGQTTGKGNVTLKELNARPMEVFMCSVLKRQGYGEGFRWLSQYID myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 22.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_064535 |
Locus ID | 56681 |
UniProt ID | Q9NR31 |
Refseq Size | 3018 |
Cytogenetics | 10q22.1 |
Refseq ORF | 594 |
Synonyms | masra2; SAR1; Sara; SARA1 |
Summary | Involved in transport from the endoplasmic reticulum to the Golgi apparatus (By similarity). Required to maintain SEC16A localization at discrete locations on the ER membrane perhaps by preventing its dissociation. SAR1A-GTP-dependent assembly of SEC16A on the ER membrane forms an organized scaffold defining endoplasmic reticulum exit sites (ERES).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402753 | SAR1A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428231 | SAR1A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402753 | Transient overexpression lysate of SAR1 homolog A (S. cerevisiae) (SAR1A), transcript variant 2 |
CNY 3,080.00 |
|
LY428231 | Transient overexpression lysate of SAR1 homolog A (S. cerevisiae) (SAR1A), transcript variant 1 |
CNY 3,080.00 |
|
PH301450 | SAR1A MS Standard C13 and N15-labeled recombinant protein (NP_064535) |
CNY 19,520.00 |
|
PH326577 | SAR1A MS Standard C13 and N15-labeled recombinant protein (NP_001136120) |
CNY 19,520.00 |
|
TP326577 | Recombinant protein of human SAR1 homolog A (S. cerevisiae) (SAR1A), transcript variant 1, 20 µg |
CNY 2,900.00 |