United States
Germany
Japan
United Kingdom
China
PPAR gamma (PPARG) (NM_138712) Human Recombinant Protein
CAT＃: TP301538
Recombinant protein of human peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 1, 20 µg
View other "PPAR gamma" proteins (17)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
| Cited in 1 publication. |
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201538 protein sequence
Red=Cloning site Green=Tags(s) MTMVDTEMPFWPTNFGISSVDLSVMEDHSHSFDIKPFTTVDFSSISTPHYEDIPFTRTDPVVADYKYDLK LQEYQSAIKVEPASPPYYSEKTQLYNKPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIR LKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESAD LRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIR IFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTR EFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQ LKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 54.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_619726 |
| Locus ID | 5468 |
| UniProt ID | P37231 |
| Refseq Size | 1892 |
| Cytogenetics | 3p25.2 |
| Refseq ORF | 1431 |
| Synonyms | CIMT1; GLM1; NR1C3; PPARG1; PPARG2; PPARG5; PPARgamma |
| Summary | This gene encodes a member of the peroxisome proliferator-activated receptor (PPAR) subfamily of nuclear receptors. PPARs form heterodimers with retinoid X receptors (RXRs) and these heterodimers regulate transcription of various genes. Three subtypes of PPARs are known: PPAR-alpha, PPAR-delta, and PPAR-gamma. The protein encoded by this gene is PPAR-gamma and is a regulator of adipocyte differentiation. Additionally, PPAR-gamma has been implicated in the pathology of numerous diseases including obesity, diabetes, atherosclerosis and cancer. Alternatively spliced transcript variants that encode different isoforms have been described. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Nuclear Hormone Receptor, Transcription Factors |
| Protein Pathways | Huntington's disease, Pathways in cancer, PPAR signaling pathway, Thyroid cancer |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
CNX-013-B2, a unique pan tissue acting rexinoid, modulates several nuclear receptors and controls multiple risk factors of the metabolic syndrome without risk of hypertriglyceridemia, hepatomegaly and body weight gain in animal models
,null,
Diabetology & Metabolic Syndrome
,PubMed ID 25143786
[PPARG]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402467 | PPARG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC408558 | PPARG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC408559 | PPARG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC417568 | PPARG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC430063 | PPARG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402467 | Transient overexpression lysate of peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 2 |
CNY 4,840.00 |
|
| LY408558 | Transient overexpression lysate of peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 3 |
CNY 3,080.00 |
|
| LY408559 | Transient overexpression lysate of peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 1 |
CNY 3,080.00 |
|
| LY417568 | Transient overexpression lysate of peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 4 |
CNY 3,080.00 |
|
| LY430063 | Transient overexpression lysate of peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 1 |
CNY 3,080.00 |
|
| PH301538 | PPARG MS Standard C13 and N15-labeled recombinant protein (NP_619726) |
CNY 19,520.00 |
|
| PH312181 | PPARG MS Standard C13 and N15-labeled recombinant protein (NP_619725) |
CNY 19,520.00 |
|
| PH312449 | PPARG MS Standard C13 and N15-labeled recombinant protein (NP_005028) |
CNY 19,520.00 |
|
| PH312502 | PPARG MS Standard C13 and N15-labeled recombinant protein (NP_056953) |
CNY 19,520.00 |
|
| TP312181 | Recombinant protein of human peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP312449 | Recombinant protein of human peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
| TP312502 | Recombinant protein of human peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 2, 20 µg |
CNY 2,900.00 |
其它PPAR gamma产品
