Thioredoxin 2 (TXN2) (NM_012473) Human Recombinant Protein
CAT#: TP301666
Recombinant protein of human thioredoxin 2 (TXN2), nuclear gene encoding mitochondrial protein, 20 µg
View other "Thioredoxin 2" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201666 protein sequence
Red=Cloning site Green=Tags(s) MAQRLLLRRFLASVISRKPSQGQWPPLTSRALQTPQCSPGGLTVTPNPARTIYTTRISLTTFNIQDGPDF QDRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMK NGDVVDKFVGIKDEDQLEAFLKKLIG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 11.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_036605 |
Locus ID | 25828 |
UniProt ID | Q99757 |
Refseq Size | 1342 |
Cytogenetics | 22q12.3 |
Refseq ORF | 498 |
Synonyms | COXPD29; MT-TRX; MTRX; TRX2; TXN |
Summary | This nuclear gene encodes a mitochondrial member of the thioredoxin family, a group of small multifunctional redox-active proteins. The encoded protein may play important roles in the regulation of the mitochondrial membrane potential and in protection against oxidant-induced apoptosis. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402220 | TXN2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402220 | Transient overexpression lysate of thioredoxin 2 (TXN2), nuclear gene encoding mitochondrial protein |
CNY 3,080.00 |
|
PH301666 | TXN2 MS Standard C13 and N15-labeled recombinant protein (NP_036605) |
CNY 19,520.00 |
|
TP720159 | Recombinant protein of human thioredoxin 2 (TXN2), nuclear gene encoding mitochondrial protein |
CNY 3,140.00 |
其它Thioredoxin 2产品