TRIM21 (NM_003141) Human Recombinant Protein
CAT#: TP302088
Recombinant protein of human tripartite motif-containing 21 (TRIM21), 20 µg
View other "TRIM21" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202088 protein sequence
Red=Cloning site Green=Tags(s) MASAARLTMMWEEVTCPICLDPFVEPVSIECGHSFCQECISQVGKGGGSVCPVCRQRFLLKNLRPNRQLA NMVNNLKEISQEAREGTQGERCAVHGERLHLFCEKDGKALCWVCAQSRKHRDHAMVPLEEAAQEYQEKLQ VALGELRRKQELAEKLEVEIAIKRADWKKTVETQKSRIHAEFVQQKNFLVEEEQRQLQELEKDEREQLRI LGEKEAKLAQQSQALQELISELDRRCHSSALELLQEVIIVLERSESWNLKDLDITSPELRSVCHVPGLKK MLRTCAVHITLDPDTANPWLILSEDRRQVRLGDTQQSIPGNEERFDSYPMVLGAQHFHSGKHYWEVDVTG KEAWDLGVCRDSVRRKGHFLLSSKSGFWTIWLWNKQKYEAGTYPQTPLHLQVPPCQVGIFLDYEAGMVSF YNITDHGSLIYSFSECAFTGPLRPFFSPGFNDGGKNTAPLTLCPLNIGSQGSTDY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 54 kDa |
Concentration | >0.1 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003132 |
Locus ID | 6737 |
UniProt ID | P19474 |
Refseq Size | 1946 |
Cytogenetics | 11p15.4 |
Refseq ORF | 1425 |
Synonyms | RNF81; Ro/SSA; RO52; SSA; SSA1 |
Summary | This gene encodes a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The encoded protein is part of the RoSSA ribonucleoprotein, which includes a single polypeptide and one of four small RNA molecules. The RoSSA particle localizes to both the cytoplasm and the nucleus. RoSSA interacts with autoantigens in patients with Sjogren syndrome and systemic lupus erythematosus. Alternatively spliced transcript variants for this gene have been described but the full-length nature of only one has been determined. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Systemic lupus erythematosus |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
TRIM21, a negative modulator of LFG in breast carcinoma MDA-MB-231 cells in vitro
,null,
International Journal of Oncology
,PubMed ID 26398169
[TRIM21]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401090 | TRIM21 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401090 | Transient overexpression lysate of tripartite motif-containing 21 (TRIM21) |
CNY 3,080.00 |
|
PH302088 | TRIM21 MS Standard C13 and N15-labeled recombinant protein (NP_003132) |
CNY 19,520.00 |