United States
Germany
Japan
United Kingdom
China
PAK4 (NM_005884) Human Recombinant Protein
CAT＃: TP302302
Recombinant protein of human p21 protein (Cdc42/Rac)-activated kinase 4 (PAK4), transcript variant 1, 20 µg
View other "PAK4" proteins (15)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
| Cited in 1 publication. |
Product images
CNY 1,999.00
CNY 2,700.00
热销推荐CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC202302 protein sequence
Red=Cloning site Green=Tags(s) MFGKRKKRVEISAPSNFEHRVHTGFDQHEQKFTGLPRQWQSLIEESARRPKPLVDPACITSIQPGAPKTI VRGSKGAKDGALTLLLDEFENMSVTRSNSLRRDSPPPPARARQENGMPEEPATTARGGPGKAGSRGRFAG HSEAGGGSGDRRRAGPEKRPKSSREGSGGPQESSRDKRPLSGPDVGTPQPAGLASGAKLAAGRPFNTYPR ADTDHPSRGAQGEPHDVAPNGPSAGGLAIPQSSSSSSRPPTRARGAPSPGVLGPHASEPQLAPPACTPAA PAVPGPPGPRSPQREPQRVSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVK KMDLRKQQRRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAV CLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKSLVGTPYWMAPELISRL PYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHKVSPSLKGFLDRLLVRDPAQR ATAAELLKHPFLAKAGPPASIVPLMRQNRTR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 63.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_005875 |
| Locus ID | 10298 |
| UniProt ID | O96013 |
| Refseq Size | 2838 |
| Cytogenetics | 19q13.2 |
| Refseq ORF | 1773 |
| Summary | PAK proteins, a family of serine/threonine p21-activating kinases, include PAK1, PAK2, PAK3 and PAK4. PAK proteins are critical effectors that link Rho GTPases to cytoskeleton reorganization and nuclear signaling. They serve as targets for the small GTP binding proteins Cdc42 and Rac and have been implicated in a wide range of biological activities. PAK4 interacts specifically with the GTP-bound form of Cdc42Hs and weakly activates the JNK family of MAP kinases. PAK4 is a mediator of filopodia formation and may play a role in the reorganization of the actin cytoskeleton. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Protein Kinase |
| Protein Pathways | Axon guidance, ErbB signaling pathway, Focal adhesion, Regulation of actin cytoskeleton, Renal cell carcinoma, T cell receptor signaling pathway |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Human CPPED1 belongs to calcineurin-like metallophosphoesterase superfamily and dephosphorylates PI3K-AKT pathway component PAK4
,Haapalainen, AM;Daddali, R;Hallman, M;Rämet, M;,
Journal of cellular and molecular medicine
,PubMed ID 34009729
[PAK4]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417002 | PAK4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423086 | PAK4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423087 | PAK4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423088 | PAK4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LY417002 | Transient overexpression lysate of p21 protein (Cdc42/Rac)-activated kinase 4 (PAK4), transcript variant 1 |
CNY 3,080.00 |
|
| LY423086 | Transient overexpression lysate of p21 protein (Cdc42/Rac)-activated kinase 4 (PAK4), transcript variant 2 |
CNY 3,080.00 |
|
| LY423087 | Transient overexpression lysate of p21 protein (Cdc42/Rac)-activated kinase 4 (PAK4), transcript variant 3 |
CNY 3,080.00 |
|
| LY423088 | Transient overexpression lysate of p21 protein (Cdc42/Rac)-activated kinase 4 (PAK4), transcript variant 5 |
CNY 4,840.00 |
|
| PH302302 | PAK4 MS Standard C13 and N15-labeled recombinant protein (NP_005875) |
CNY 19,520.00 |
|
| PH306847 | PAK4 MS Standard C13 and N15-labeled recombinant protein (NP_001014831) |
CNY 19,520.00 |
|
| PH317097 | PAK4 MS Standard C13 and N15-labeled recombinant protein (NP_001014832) |
CNY 19,520.00 |
|
| TP306847 | Recombinant protein of human p21 protein (Cdc42/Rac)-activated kinase 4 (PAK4), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP317097 | Recombinant protein of human p21 protein (Cdc42/Rac)-activated kinase 4 (PAK4), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP723905 | Purified recombinant kinase domain protein of human p21 protein (Cdc42/Rac)-activated kinase 4 (PAK4), transcript variant 1, 10 µg |
CNY 8,025.00 |
|
| TP723906 | Purified recombinant kinase domain protein of human p21 protein (Cdc42/Rac)-activated kinase 4 (PAK4), transcript variant 1, 100 µg |
CNY 30,956.00 |
PAK4 mouse monoclonal antibody, clone OTI1C7 (formerly 1C7)
