TTC33 (NM_012382) Human Recombinant Protein
CAT#: TP302360
Recombinant protein of human tetratricopeptide repeat domain 33 (TTC33), 20 µg
View other "TTC33" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202360 protein sequence
Red=Cloning site Green=Tags(s) MASFGWKRKIGEKVSKVTSQQFEAEAADEKDVVDNDEGNWLHAIKRRKEILLEGCAEKSKQLKDEGASLA ENKRYREAIQKWDEALQLTPNDATLYEMKSQVLMSLHEMFPAVHAAEMAVQQNPHSWESWQTLGRAQLGL GEIILAIRSFQVALHIYPMNPEIWKEDLSWARTLQEQQKVAQRIKKSEAPAEVTHFSPKSIPDYDFESDE IVAVCAAIAEKEKTVSANKTMVIVSASGAIETVTEKEDGATPPDGSVFIKAR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 29.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | Enzyme substrate (PMID: 29804834) |
Reference Data | |
RefSeq | NP_036514 |
Locus ID | 23548 |
UniProt ID | Q6PID6 |
Refseq Size | 5519 |
Cytogenetics | 5p13.1 |
Refseq ORF | 786 |
Synonyms | OSRF |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Time-Resolved Analysis Reveals Rapid Dynamics and Broad Scope of the CBP/p300 Acetylome
,Weinert, BT;Narita, T;Satpathy, S;Srinivasan, B;Hansen, BK;Schölz, C;Hamilton, WB;Zucconi, BE;Wang, WW;Liu, WR;Brickman, JM;Kesicki, EA;Lai, A;Bromberg, KD;Cole, PA;Choudhary, C;,
Cell
,PubMed ID 29804834
[TTC33]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415822 | TTC33 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415822 | Transient overexpression lysate of tetratricopeptide repeat domain 33 (TTC33) |
CNY 3,080.00 |
|
PH302360 | TTC33 MS Standard C13 and N15-labeled recombinant protein (NP_036514) |
CNY 19,520.00 |