ITM2B (NM_021999) Human Recombinant Protein
CAT#: TP302377
Recombinant protein of human integral membrane protein 2B (ITM2B), 20 µg
View other "ITM2B" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202377 protein sequence
Red=Cloning site Green=Tags(s) MVKVTFNSALAQKETKKDEPKSGEEALIIPPDAVAVDCKDPDDVVPVGQRRAWCWCMCFGLAFMLAGVIL GGAYLYKYFALQPDDVYYCGIKYIKDDVILNEPSADAPAALYQTIEENIKIFEEEEVEFISVPVPEFADS DPANIVHDFNKKLTAYLDLNLDKCYVIPLNTSIVMPPRNLLELLINIKAGTYLPQSYLIHEHMVITDRIE NIDHLGFFIYRLCHDKETYKLQRRETIKGIQKREASNCFAIRHFENKFAVETLICS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 30.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_068839 |
Locus ID | 9445 |
UniProt ID | Q9Y287, A0A384MDP7 |
Refseq Size | 1896 |
Cytogenetics | 13q14.2 |
Refseq ORF | 798 |
Synonyms | ABRI; BRI; BRI2; BRICD2B; E3-16; E25B; FBD; imBRI2; RDGCA |
Summary | Amyloid precursor proteins are processed by beta-secretase and gamma-secretase to produce beta-amyloid peptides which form the characteristic plaques of Alzheimer disease. This gene encodes a transmembrane protein which is processed at the C-terminus by furin or furin-like proteases to produce a small secreted peptide which inhibits the deposition of beta-amyloid. Mutations which result in extension of the C-terminal end of the encoded protein, thereby increasing the size of the secreted peptide, are associated with two neurogenerative diseases, familial British dementia and familial Danish dementia. [provided by RefSeq, Oct 2009] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411840 | ITM2B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411840 | Transient overexpression lysate of integral membrane protein 2B (ITM2B) |
CNY 3,080.00 |
|
PH302377 | ITM2B MS Standard C13 and N15-labeled recombinant protein (NP_068839) |
CNY 19,520.00 |
|
TP721036 | Purified recombinant protein of Human integral membrane protein 2B (ITM2B) |
CNY 3,140.00 |