United States
Germany
Japan
United Kingdom
China
WIBG (PYM1) (NM_032345) Human Recombinant Protein
CAT＃: TP302988
Recombinant protein of human within bgcn homolog (Drosophila) (WIBG), transcript variant 1, 20 µg
View other "WIBG" proteins (8)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC202988 protein sequence
Red=Cloning site Green=Tags(s) MEAAGSPAATETGKYIASTQRPDGTWRKQRRVKEGYVPQEEVPVYENKYVKFFKSKPELPPGLSPEATAP VTPSRPEGGEPGLSKTAKRNLKRKEKRRQQQEKGEAEALSRTLDKVSLEETAQLPSAPQGSRAAPTAASD QPDSAATTEKAKKIKNLKKKLRQVEELQQRIQAGEVSQPSKEQLEKLARRRALEEELEDLELGL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 22.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_115721 |
| Locus ID | 84305 |
| UniProt ID | Q9BRP8 |
| Refseq Size | 1244 |
| Cytogenetics | 12q13.2 |
| Refseq ORF | 612 |
| Synonyms | PYM; WIBG |
| Summary | Key regulator of the exon junction complex (EJC), a multiprotein complex that associates immediately upstream of the exon-exon junction on mRNAs and serves as a positional landmark for the intron exon structure of genes and directs post-transcriptional processes in the cytoplasm such as mRNA export, nonsense-mediated mRNA decay (NMD) or translation. Acts as an EJC disassembly factor, allowing translation-dependent EJC removal and recycling by disrupting mature EJC from spliced mRNAs. Its association with the 40S ribosomal subunit probably prevents a translation-independent disassembly of the EJC from spliced mRNAs, by restricting its activity to mRNAs that have been translated. Interferes with NMD and enhances translation of spliced mRNAs, probably by antagonizing EJC functions. May bind RNA; the relevance of RNA-binding remains unclear in vivo, RNA-binding was detected by PubMed:14968132, while PubMed:19410547 did not detect RNA-binding activity independently of the EJC.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410182 | WIBG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428389 | WIBG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY410182 | Transient overexpression lysate of within bgcn homolog (Drosophila) (WIBG), transcript variant 1 |
CNY 3,080.00 |
|
| LY428389 | Transient overexpression lysate of within bgcn homolog (Drosophila) (WIBG), transcript variant 2 |
CNY 3,080.00 |
|
| PH302988 | WIBG MS Standard C13 and N15-labeled recombinant protein (NP_115721) |
CNY 19,520.00 |
|
| PH327106 | WIBG MS Standard C13 and N15-labeled recombinant protein (NP_001137325) |
CNY 14,250.00 |
|
| TP327106 | Recombinant protein of human within bgcn homolog (Drosophila) (WIBG), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP720529 | Recombinant protein of human within bgcn homolog (Drosophila) (WIBG), transcript variant 2 |
CNY 3,140.00 |
