Cystatin A (CSTA) (NM_005213) Human Recombinant Protein
CAT#: TP303115
Recombinant protein of human cystatin A (stefin A) (CSTA), 20 µg
View other "Cystatin A" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203115 protein sequence
Red=Cloning site Green=Tags(s) MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVF KSLPGQNEDLVLTGYQVDKNKDDELTGF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 10.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005204 |
Locus ID | 1475 |
UniProt ID | P01040 |
Refseq Size | 838 |
Cytogenetics | 3q21.1 |
Refseq ORF | 294 |
Synonyms | AREI; PSS4; STF1; STFA |
Summary | The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins, and kininogens. This gene encodes a stefin that functions as a cysteine protease inhibitor, forming tight complexes with papain and the cathepsins B, H, and L. The protein is one of the precursor proteins of cornified cell envelope in keratinocytes and plays a role in epidermal development and maintenance. Stefins have been proposed as prognostic and diagnostic tools for cancer. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401596 | CSTA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401596 | Transient overexpression lysate of cystatin A (stefin A) (CSTA) |
CNY 3,080.00 |
|
PH303115 | CSTA MS Standard C13 and N15-labeled recombinant protein (NP_005204) |
CNY 19,520.00 |
|
TP720597 | Purified recombinant protein of Human cystatin A (stefin A) (CSTA) |
CNY 3,140.00 |
其它Cystatin A产品