PRMT5 (NM_006109) Human Recombinant Protein
CAT#: TP303458
Recombinant protein of human protein arginine methyltransferase 5 (PRMT5), transcript variant 1, 20 µg
View other "PRMT5" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203458 protein sequence
Red=Cloning site Green=Tags(s) MAAMAVGGAGGSRVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSD LLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTN HIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGA DLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSY LQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVP EEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDM REWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREK DRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLY QDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTG RSYTIGL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 72.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006100 |
Locus ID | 10419 |
UniProt ID | O14744 |
Refseq Size | 2541 |
Cytogenetics | 14q11.2 |
Refseq ORF | 1911 |
Synonyms | HRMT1L5; HSL7; IBP72; JBP1; SKB1; SKB1Hs |
Summary | This gene encodes an enzyme that belongs to the methyltransferase family. The encoded protein catalyzes the transfer of methyl groups to the amino acid arginine, in target proteins that include histones, transcriptional elongation factors and the tumor suppressor p53. This gene plays a role in several cellular processes, including transcriptional regulation, and the assembly of small nuclear ribonucleoproteins. A pseudogene of this gene has been defined on chromosome 4. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Sep 2015] |
Protein Families | Stem cell - Pluripotency |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Aberrant expression of CITED2 promotes prostate cancer metastasis by activating the nucleolin-AKT pathway
,Shin, SH;Lee, GY;Lee, M;Kang, J;Shin, HW;Chun, YS;Park, JW;,
Nat Commun
,PubMed ID 30291252
[PRMT5]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416847 | PRMT5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422095 | PRMT5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY416847 | Transient overexpression lysate of protein arginine methyltransferase 5 (PRMT5), transcript variant 1 |
CNY 3,080.00 |
|
LY422095 | Transient overexpression lysate of protein arginine methyltransferase 5 (PRMT5), transcript variant 2 |
CNY 4,840.00 |
|
PH303458 | PRMT5 MS Standard C13 and N15-labeled recombinant protein (NP_006100) |
CNY 19,520.00 |