RERG (NM_032918) Human Recombinant Protein
CAT#: TP303564
Recombinant protein of human RAS-like, estrogen-regulated, growth inhibitor (RERG), 20 µg
View other "RERG" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203564 protein sequence
Red=Cloning site Green=Tags(s) MAKSAEVKLAIFGRAGVGKSALVVRFLTKRFIWEYDPTLESTYRHQATIDDEVVSMEILDTAGQEDTIQR EGHMRWGEGFVLVYDITDRGSFEEVLPLKNILDEIKKPKNVTLILVGNKADLDHSRQVSTEEGEKLATEL ACAFYECSACTGEGNITEIFYELCREVRRRRMVQGKTRRRSSTTHVKQAINKMLTKISS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 22.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_116307 |
Locus ID | 85004 |
UniProt ID | Q96A58, A0A024RAT4 |
Refseq Size | 2325 |
Cytogenetics | 12p12.3 |
Refseq ORF | 597 |
Summary | RERG, a member of the RAS superfamily of GTPases, inhibits cell proliferation and tumor formation (Finlin et al., 2001 [PubMed 11533059]).[supplied by OMIM, Mar 2009] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409869 | RERG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC434024 | RERG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409869 | Transient overexpression lysate of RAS-like, estrogen-regulated, growth inhibitor (RERG) |
CNY 3,080.00 |
|
LY434024 | Transient overexpression lysate of RAS-like, estrogen-regulated, growth inhibitor (RERG), transcript variant 2 |
CNY 3,080.00 |
|
PH303564 | RERG MS Standard C13 and N15-labeled recombinant protein (NP_116307) |
CNY 19,520.00 |