beta Actin (ACTB) (NM_001101) Human Recombinant Protein
CAT#: TP303643
Recombinant protein of human actin, beta (ACTB), 20 µg
View other "beta Actin" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 9 publications. |
CNY 300.00
CNY 1,430.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203643 representing NM_001101
Red=Cloning site Green=Tags(s) MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYP IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVL SLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVR DIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFN SIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLS TFQQMWISKQEYDESGPSIVHRKCF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 41.6 kDa |
Concentration | >0.1 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001092 |
Locus ID | 60 |
UniProt ID | P60709, Q1KLZ0 |
Refseq Size | 1793 |
Cytogenetics | 7p22.1 |
Refseq ORF | 1125 |
Synonyms | BRWS1; PS1TP5BP1 |
Summary | This gene encodes one of six different actin proteins. Actins are highly conserved proteins that are involved in cell motility, structure, integrity, and intercellular signaling. The encoded protein is a major constituent of the contractile apparatus and one of the two nonmuscle cytoskeletal actins that are ubiquitously expressed. Mutations in this gene cause Baraitser-Winter syndrome 1, which is characterized by intellectual disability with a distinctive facial appearance in human patients. Numerous pseudogenes of this gene have been identified throughout the human genome. [provided by RefSeq, Aug 2017] |
Protein Families | ES Cell Differentiation/IPS |
Protein Pathways | Adherens junction, Arrhythmogenic right ventricular cardiomyopathy (ARVC), Dilated cardiomyopathy, Focal adhesion, Hypertrophic cardiomyopathy (HCM), Leukocyte transendothelial migration, Pathogenic Escherichia coli infection, Regulation of actin cytoskeleton, Tight junction, Vibrio cholerae infection, Viral myocarditis |
Citations (9)
The use of this Proteins has been cited in the following citations: |
---|
Bilirubin Oxidation End Products (BOXes) Induce Neuronal Oxidative Stress Involving the Nrf2 Pathway
,null,
Oxidative Medicine and Cellular Longevity
,PubMed ID 34373769
[ACTB]
|
The Huntingtin-interacting protein SETD2/HYPB is an actin lysine methyltransferase
,Seervai, RNH;Jangid, RK;Karki, M;Tripathi, DN;Jung, SY;Kearns, SE;Verhey, KJ;Cianfrocco, MA;Millis, BA;Tyska, MJ;Mason, FM;Rathmell, WK;Park, IY;Dere, R;Walker, CL;,
Sci Adv
,PubMed ID 33008892
[ACTB]
|
DCAF1 regulates Treg senescence via the ROS axis during immunological aging
,null,
The Journal of Clinical Investigation
,PubMed ID 32730228
[ACTB]
|
SETD2 is an actin lysine methyltransferase
,Seervai, RNH;Jangid, RK;Karki, M;Tripathi, DN;,
bioRxiv
[ACTB]
|
Myeloid-Derived Lymphatic Endothelial Cell Progenitors Significantly Contribute to Lymphatic Metastasis in Clinical Breast Cancer
,Volk-Draper, L;Patel, R;Bhattarai, N;Yang, J;Wilber, A;DeNardo, D;Ran, S;,
Am. J. Pathol.
,PubMed ID 31421071
[ACTB]
|
Moringa oleifera Leaf Petroleum Ether Extract Inhibits Lipogenesis by Activating the AMPK Signaling Pathway
,null,
Frontiers in Pharmacology
,PubMed ID 30618744
[ACTB]
|
Effect of the proinflammatory cytokine TNF-ñ on intestinal riboflavin uptake: inhibition mediated via transcriptional mechanism(s)
,null,
American Journal of Physiology - Cell Physiology
,PubMed ID 30156861
[ACTB]
|
Ascites Increases Expression/Function of Multidrug Resistance Proteins in Ovarian Cancer Cells
,null,
PLoS ONE
,PubMed ID 26148191
[ACTB]
|
Developmental Expression of Orphan G Protein-Coupled Receptor 50 in the Mouse Brain
,null,
ACS Chemical Neuroscience
,PubMed ID 22860215
[ACTB]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
其它beta Actin产品