PCP4 (NM_006198) Human Recombinant Protein
CAT#: TP303796
Recombinant protein of human Purkinje cell protein 4 (PCP4), 20 µg
View other "PCP4" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203796 protein sequence
Red=Cloning site Green=Tags(s) MSERQGAGATNGKDKTSGENDGQKKVQEEFDIDMDAPETERAAVAIQSQFRKFQKKKAGSQS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 6.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006189 |
Locus ID | 5121 |
UniProt ID | P48539 |
Refseq Size | 566 |
Cytogenetics | 21q22.2 |
Refseq ORF | 186 |
Synonyms | PEP-19 |
Summary | Functions as a modulator of calcium-binding by calmodulin. Thereby, regulates calmodulin activity and the different processes it controls (PubMed:19106096, PubMed:23204517, PubMed:27876793). For instance, may play a role in neuronal differentiation through activation of calmodulin-dependent kinase signaling pathways (PubMed:21491429).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416805 | PCP4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416805 | Transient overexpression lysate of Purkinje cell protein 4 (PCP4) |
CNY 3,080.00 |
|
PH303796 | PCP4 MS Standard C13 and N15-labeled recombinant protein (NP_006189) |
CNY 19,520.00 |