CD99 (NM_002414) Human Recombinant Protein
CAT#: TP304056
Purified recombinant protein of Homo sapiens CD99 molecule (CD99), transcript variant 1, 20 µg
View other "CD99" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204056 protein sequence
Red=Cloning site Green=Tags(s) MARGAALALLLFGLLGVLVAAPDGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPP NPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEADAPGVIPGIVGAVVVAVAG AISSFIAYQKKKLCFKENAEQGEVDMESHRNANAEPAVQRTLLEK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 16.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002405 |
Locus ID | 4267 |
UniProt ID | P14209 |
Refseq Size | 1255 |
Cytogenetics | X;Y |
Refseq ORF | 555 |
Synonyms | HBA71; MIC2; MIC2X; MIC2Y; MSK5X |
Summary | The protein encoded by this gene is a cell surface glycoprotein involved in leukocyte migration, T-cell adhesion, ganglioside GM1 and transmembrane protein transport, and T-cell death by a caspase-independent pathway. In addition, the encoded protein may have the ability to rearrange the actin cytoskeleton and may also act as an oncosuppressor in osteosarcoma. This gene is found in the pseudoautosomal region of chromosomes X and Y and escapes X-chromosome inactivation. There is a related pseudogene located immediately adjacent to this locus. [provided by RefSeq, Mar 2016] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Cell adhesion molecules (CAMs), Leukocyte transendothelial migration |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Clofarabine inhibits Ewing sarcoma growth through a novel molecular mechanism involving direct binding to CD99
,null,
Oncogene
,PubMed ID 29382926
[CD99]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400863 | CD99 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426583 | CD99 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400863 | Transient overexpression lysate of CD99 molecule (CD99), transcript variant 1 |
CNY 3,080.00 |
|
LY426583 | Transient overexpression lysate of CD99 molecule (CD99), transcript variant 2 |
CNY 3,080.00 |
|
PH304056 | CD99 MS Standard C13 and N15-labeled recombinant protein (NP_002405) |
CNY 14,250.00 |
|
TP720374 | Recombinant protein of human CD99 molecule (CD99), transcript variant 2 |
CNY 3,140.00 |