CCDC134 (NM_024821) Human Recombinant Protein
CAT#: TP304377
Recombinant protein of human coiled-coil domain containing 134 (CCDC134), 20 µg
View other "CCDC134" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204377 protein sequence
Red=Cloning site Green=Tags(s) MDLLQFLAFLFVLLLSGMGATGTLRTSLDPSLEIYKKMFEVKRREQLLALKNLAQLNDIHQQYKILDVML KGLFKVLEDSRTVLTAADVLPDGPFPQDEKLKDAFSHVVENTAFFGDVVLRFPRIVHYYFDHNSNWNLLI RWGISFCNQTGVFNQGPHSPILSLMAQELGISEKDSNFQNPFKIDRTEFIPSTDPFQKALREEEKRRKKE EKRKEIRKGPRISRSQSEL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 26.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_079097 |
Locus ID | 79879 |
UniProt ID | Q9H6E4 |
Refseq Size | 1279 |
Cytogenetics | 22q13.2 |
Refseq ORF | 687 |
Summary | In extracellular secreted form, promotes proliferation and activation of CD8(+) T cells, suggesting a cytokine-like function (PubMed:25125657). Enhances cytotoxic anti-tumor activity of CD8(+) T cells (PubMed:25125657). May inhibit ERK and JNK signaling activity (PubMed:18087676, PubMed:23070808). May suppress cell migration and invasion activity, via its effects on ERK and JNK signaling (PubMed:23070808).[UniProtKB/Swiss-Prot Function] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411042 | CCDC134 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411042 | Transient overexpression lysate of coiled-coil domain containing 134 (CCDC134) |
CNY 3,080.00 |
|
PH304377 | CCDC134 MS Standard C13 and N15-labeled recombinant protein (NP_079097) |
CNY 19,520.00 |
|
TP721226 | Purified recombinant protein of Human coiled-coil domain containing 134 (CCDC134) |
CNY 3,140.00 |
其它CCDC134产品