UBE2Q2 (NM_173469) Human Recombinant Protein
CAT#: TP304433
Recombinant protein of human ubiquitin-conjugating enzyme E2Q family member 2 (UBE2Q2), transcript variant 1, 20 µg
View other "UBE2Q2" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204433 representing NM_173469
Red=Cloning site Green=Tags(s) MSVSGLKAELKFLASIFDKNHERFRIVSWKLDELHCQFLVPQQGSPHSLPPPLTLHCNITESYPSSSPIW FVDSEDPNLTSVLERLEDTKNNNLLRQQLKWLICELCSLYNLPKHLDVEMLDQPLPTGQNGTTEEVTSEE EEEEEEMAEDIEDLDHYEMKEEEPISGKKSEDEGIEKENLAILEKIRKTQRQDHLNGAVSGSVQASDRLM KELRDIYRSQSYKTGIYSVELINDSLYDWHVKLQKVDPDSPLHSDLQILKEKEGIEYILLNFSFKDNFPF DPPFVRVVLPVLSGGYVLGGGALCMELLTKQGWSSAYSIESVIMQINATLVKGKARVQFGANKNQYNLAR AQQSYNSIVQIHEKNGWYTPPKEDG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 42.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_775740 |
Locus ID | 92912 |
UniProt ID | Q8WVN8 |
Refseq Size | 2939 |
Cytogenetics | 15q24.2 |
Refseq ORF | 1125 |
Summary | Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-48'-linked polyubiquitination.[UniProtKB/Swiss-Prot Function] |
Protein Pathways | Ubiquitin mediated proteolysis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406622 | UBE2Q2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428824 | UBE2Q2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406622 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2Q family member 2 (UBE2Q2), transcript variant 1 |
CNY 3,080.00 |
|
LY428824 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2Q family member 2 (UBE2Q2), transcript variant 2 |
CNY 3,080.00 |
|
PH304433 | UBE2Q2 MS Standard C13 and N15-labeled recombinant protein (NP_775740) |
CNY 19,520.00 |