MRGPRF (NM_145015) Human Recombinant Protein
CAT#: TP304556
Recombinant protein of human MAS-related GPR, member F (MRGPRF), transcript variant 2, 20 µg
View other "MRGPRF" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204556 protein sequence
Red=Cloning site Green=Tags(s) MAGNCSWEAHPGNRNKMCPGLSEAPELYSRGFLTIEQIAMLPPPAVMNYIFLLLCLCGLVGNGLVLWFFG FSIKRNPFSIYFLHLASADVGYLFSKAVFSILNTGGFLGTFADYIRSVCRVLGLCMFLTGVSLLPAVSAE RCASVIFPAWYWRRRPKRLSAVVCALLWVLSLLVTCLHNYFCVFLGRGAPGAACRHMDIFLGILLFLLCC PLMVLPCLALILHVECRARRRQRSAKLNHVILAMVSVFLVSSIYLGIDWFLFWVFQIPAPFPEYVTDLCI CINSSAKPIVYFLAGRDKSQRLWEPLRVVFQRALRDGAELGEAGGSTPNTVTMEMQCPPGNAS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 38 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_659452 |
Locus ID | 116535 |
UniProt ID | Q96AM1, A0A024R5F0 |
Refseq Size | 2308 |
Cytogenetics | 11q13.3 |
Refseq ORF | 1029 |
Synonyms | GPR140; GPR168; MRGF; RTA |
Summary | Orphan receptor. May bind to a neuropeptide and may regulate nociceptor function and/or development, including the sensation or modulation of pain (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403413 | MRGPRF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420613 | MRGPRF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426018 | MRGPRF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403413 | Transient overexpression lysate of MAS-related GPR, member F (MRGPRF), transcript variant 2 |
CNY 3,080.00 |
|
LY420613 | Transient overexpression lysate of MAS-related GPR, member F (MRGPRF), transcript variant 1 |
CNY 3,080.00 |
|
PH304556 | MRGPRF MS Standard C13 and N15-labeled recombinant protein (NP_659452) |
CNY 19,520.00 |