LOX 1 (OLR1) (NM_002543) Human Recombinant Protein
CAT#: TP304704
Recombinant protein of human oxidized low density lipoprotein (lectin-like) receptor 1 (OLR1), 20 µg
View other "LOX 1" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204704 protein sequence
Red=Cloning site Green=Tags(s) MTFDDLKIQTVKDQPDEKSNGKKAKGLQFLYSPWWCLAAATLGVLCLGLVVTIMVLGMQLSQVSDLLTQE QANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANC SAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRN PSYPWLWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLRAQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 30.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | Binding assay (PMID: 28377266) |
Reference Data | |
RefSeq | NP_002534 |
Locus ID | 4973 |
UniProt ID | P78380, A0A024RAU0 |
Refseq Size | 2533 |
Cytogenetics | 12p13.2 |
Refseq ORF | 819 |
Synonyms | CLEC8A; LOX1; LOXIN; SCARE1; SLOX1 |
Summary | This gene encodes a low density lipoprotein receptor that belongs to the C-type lectin superfamily. This gene is regulated through the cyclic AMP signaling pathway. The encoded protein binds, internalizes and degrades oxidized low-density lipoprotein. This protein may be involved in the regulation of Fas-induced apoptosis. This protein may play a role as a scavenger receptor. Mutations of this gene have been associated with atherosclerosis, risk of myocardial infarction, and may modify the risk of Alzheimer's disease. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Feb 2010] |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Protein Pathways | PPAR signaling pathway |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
The lipid moiety 7-ketocholesteryl-9-carboxynonanoate mediates binding interaction of oxLDL to LOX-1 and upregulates ABCA1 expression through PPARγ
,Li, J;Xiu, Z;Wang, R;Yu, C;Chi, Y;Qin, J;Fu, C;Matsuura, E;Liu, Q;,
Life Sci.
,PubMed ID 28377266
[OLR1]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400904 | OLR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC432642 | OLR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400904 | Transient overexpression lysate of oxidized low density lipoprotein (lectin-like) receptor 1 (OLR1) |
CNY 3,080.00 |
|
LY432642 | Transient overexpression lysate of oxidized low density lipoprotein (lectin-like) receptor 1 (OLR1), transcript variant 2 |
CNY 3,080.00 |
|
PH304704 | OLR1 MS Standard C13 and N15-labeled recombinant protein (NP_002534) |
CNY 19,520.00 |
|
TP720433 | Recombinant protein of human oxidized low density lipoprotein (lectin-like) receptor 1 (OLR1), transcript variant 2. |
CNY 3,140.00 |