C9orf78 (NM_016520) Human Recombinant Protein
CAT#: TP304997
Recombinant protein of human chromosome 9 open reading frame 78 (C9orf78), 20 µg
View other "C9orf78" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204997 protein sequence
Red=Cloning site Green=Tags(s) MPVVRKIFRRRRGDSESEEDEQDSEEVRLKLEETREVQNLRKRPNGVSAVALLVGEKVQEETTLVDDPFQ MKTGGMVDMKKLKERGKDKISEEEDLHLGTSFSAETNRRDEDADMMKYIETELKKRKGIVEHEEQKVKSK NAEDCLYELPENIRVSSAKKTEEMLSNQMLSGIPEVDLGIDAKIKNIISTEDAKARLLAEQQSKKKDSET SFVPTNMAVNYVQHNRFYHEELNAPIRRNKEEPKARPLRVGDTEKPEPERSPPNRKRPANEKATDDYHYE KFKKMNRRY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 33.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057604 |
Locus ID | 51759 |
UniProt ID | Q9NZ63 |
Refseq Size | 1835 |
Cytogenetics | 9q34.11 |
Refseq ORF | 867 |
Synonyms | bA409K20.3; CSU2; HCA59; HSPC220 |
Summary | Involved in the regulation of telomeric heterochromatin assembly and control of telomere length.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413954 | C9orf78 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413954 | Transient overexpression lysate of chromosome 9 open reading frame 78 (C9orf78) |
CNY 3,080.00 |
|
PH304997 | C9orf78 MS Standard C13 and N15-labeled recombinant protein (NP_057604) |
CNY 19,520.00 |
|
TP710188 | Purified recombinant protein of Human chromosome 9 open reading frame 78 (C9orf78), full length, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4,020.00 |
其它C9orf78产品