United States
Germany
Japan
United Kingdom
China
hnRNP F (HNRNPF) (NM_004966) Human Recombinant Protein
CAT＃: TP305100
Recombinant protein of human heterogeneous nuclear ribonucleoprotein F (HNRNPF), transcript variant 3, 20 µg
View other "hnRNP F" proteins (25)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 1,999.00
CNY 2,700.00
热销推荐CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC205100 protein sequence
Red=Cloning site Green=Tags(s) MMLGPEGGEGFVVKLRGLPWSCSVEDVQNFLSDCTIHDGAAGVHFIYTREGRQSGEAFVELGSEDDVKMA LKKDRESMGHRYIEVFRSHRTEMDWVLKHSGPNSADSANDGFVRLRGLPFGCTKEEIVQFFSGLEIVPNG ITLPVDPEGKITGEAFVQFASQELAEKALGKHKERIGHRYIEVFKSSQEEVRSYSDPPLKFMSVQRPGPY DRPGTARRYIGIVKQAGLERMRPGAYSTGYGGYEEYSGLSDGYGFTTDLFGRDLSYCLSGMYDHRYGDSE FTVQSTTGHCVHMRGLPYKATENDIYNFFSPLNPVRVHIEIGPDGRVTGEADVEFATHEEAVAAMSKDRA NMQHRYIELFLNSTTGASNGAYSSQVMQGMGVSAAQATYSGLESQSVSGCYGAGYSGQNSMGGYD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 45.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_004957 |
| Locus ID | 3185 |
| UniProt ID | P52597 |
| Refseq Size | 2651 |
| Cytogenetics | 10q11.21 |
| Refseq ORF | 1245 |
| Synonyms | HNRPF; mcs94-1; OK/SW-cl.23 |
| Summary | This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins that complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and regulate alternative splicing, polyadenylation, and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has three repeats of quasi-RRM domains that bind to RNAs which have guanosine-rich sequences. This protein is very similar to the family member hnRPH. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401544 | HNRNPF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420552 | HNRNPF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420553 | HNRNPF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420554 | HNRNPF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420555 | HNRNPF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420556 | HNRNPF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426000 | HNRNPF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426004 | HNRNPF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401544 | Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein F (HNRNPF), transcript variant 3 |
CNY 3,080.00 |
|
| LY420552 | Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein F (HNRNPF), transcript variant 2 |
CNY 3,080.00 |
|
| LY420553 | Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein F (HNRNPF), transcript variant 4 |
CNY 3,080.00 |
|
| LY420554 | Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein F (HNRNPF), transcript variant 5 |
CNY 3,080.00 |
|
| LY420555 | Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein F (HNRNPF), transcript variant 6 |
CNY 3,080.00 |
|
| LY420556 | Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein F (HNRNPF), transcript variant 1 |
CNY 3,080.00 |
|
| LY426000 | Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein F (HNRNPF), transcript variant 2 |
CNY 3,080.00 |
|
| LY426004 | Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein F (HNRNPF), transcript variant 1 |
CNY 3,080.00 |
|
| PH305100 | HNRNPF MS Standard C13 and N15-labeled recombinant protein (NP_004957) |
CNY 19,520.00 |
|
| PH312612 | HNRNPF MS Standard C13 and N15-labeled recombinant protein (NP_001091675) |
CNY 14,250.00 |
|
| PH312850 | HNRNPF MS Standard C13 and N15-labeled recombinant protein (NP_001091674) |
CNY 14,250.00 |
|
| PH313874 | HNRNPF MS Standard C13 and N15-labeled recombinant protein (NP_001091677) |
CNY 14,250.00 |
|
| PH317995 | HNRNPF MS Standard C13 and N15-labeled recombinant protein (NP_001091676) |
CNY 14,250.00 |
|
| TP312612 | Purified recombinant protein of Homo sapiens heterogeneous nuclear ribonucleoprotein F (HNRNPF), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
| TP312850 | Purified recombinant protein of Homo sapiens heterogeneous nuclear ribonucleoprotein F (HNRNPF), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP313874 | Purified recombinant protein of Homo sapiens heterogeneous nuclear ribonucleoprotein F (HNRNPF), transcript variant 6, 20 µg |
CNY 2,900.00 |
|
| TP317995 | Purified recombinant protein of Homo sapiens heterogeneous nuclear ribonucleoprotein F (HNRNPF), transcript variant 5, 20 µg |
CNY 2,900.00 |
其它hnRNP F产品
HNRNPF (hnRNP F) mouse monoclonal antibody, clone OTI5F5 (formerly 5F5)
